KEGG   Myxococcus xanthus: MXAN_0171Help
Entry
MXAN_0171         CDS       T00366                                 

Definition
(GenBank) cation-binding protein, hemerythrin HHE family
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: ABF89881
UniProt: Q1DFW9
Position
complement(206411..206995)
Genome map
AA seq 194 aa AA seqDB search
MFHGSRAGRASPRAWSGDCDVLRACGALEDTEPIPRSTDVDVIDLLIQQHRELEALFDAC
RAAKDDASKQELGIQLAEALTLHTTIEERWVYPAARRVVEEKLIQDSVEEHGEMTELIAQ
MIRARNDPQKLVALFGELEKVVKDHVTMEERDVLPKLGQKVTEQDLGMSCKDIVRTASEV
RREEMQKLQGQANA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgttccacgggagcagagcgggcagggcttctcctcgtgcctggagcggtgattgcgac
gtcctgcgagcatgcggagccttggaggacaccgaaccgattccaaggagcacagacgtg
gacgtgattgacctgttgattcagcagcaccgtgagttggaagcgctgttcgatgcctgt
cgcgcggcgaaggacgatgcgagcaagcaagagcttggcatccagctcgcggaggcgctc
acgttgcacaccacgattgaagaacgctgggtgtaccccgccgcgcgccgggtggtggag
gagaagctgattcaggactccgtcgaggagcacggggagatgacggagctcatcgcccag
atgattcgcgcgcgcaacgacccgcagaagctggtggccctgttcggcgaactggagaag
gtggtgaaggaccacgtgacgatggaggagcgcgacgtactgcccaagctcggtcagaag
gtcaccgagcaggacctgggcatgtcgtgcaaggacatcgtccgcaccgcctccgaggtc
cgccgcgaggagatgcagaagctccagggtcaggcgaacgcctga

DBGET integrated database retrieval system