KEGG   Myxococcus xanthus: MXAN_0172Help
Entry
MXAN_0172         CDS       T00366                                 

Definition
(GenBank) sigma-54 dependent DNA-binding response regulator
  KO
K11384  two-component system, NtrC family, response regulator AlgB
Organism
mxa  Myxococcus xanthus
Pathway
mxa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MXAN_0172
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mxa02022]
    MXAN_0172
Two-component system [BR:mxa02022]
 NtrC family
  KinB-AlgB [MD:M00505]
   MXAN_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 AAA_5 AAA HTH_8 Mg_chelatase AAA_2 AAA_16 AAA_22 AAA_30 FleQ AAA_3 HTH_23 HTH_psq DUF1858 TIP49 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ABF89084
UniProt: Q1DFW8
Position
complement(207019..208380)
Genome map
AA seq 453 aa AA seqDB search
MDIGERPMRVLVVDDERNIRHTLRVCLEGFGCEVREAATPEAALAALAQGPADLAFVDLR
LGTASGMELLPRLLAESPHLDVVLITAYATFDTAVEAMRRGARDYLPKPFTPAQIRHAVE
KARRHQELASQLENLEGQLSQAVPEATLETASPAMHAAIGLLTRAAASDAAVLLRGESGT
GKGVLARALHSMSARRRRPFVTVNCPTLSEQLLASELFGHVRGAFTGAVKDQPGRVEAAE
GGTLFLDEIAEMSPGLQAQLLRFLQEKQFERLGEGRTRKADVRVVAATNRDLEKDVAEGR
FREDLLYRLNVIEVKLPSLRERPEDLLSLARRFVSFFARAAQRPPPELSPATEKMLLAYG
WPGNVRELRNAMERALIVWPAEVLEPQAFPDRIAAAGSPVMTLGGPHTLEDIEREHVLRV
MASAPTLDEAARVLGIDASTLWRKRKKYESGEG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggacattggtgagcgccccatgcgggtgctggtggtggacgacgagcggaacatccgc
cacaccctgcgcgtgtgcctggagggcttcggctgtgaggtccgcgaggcggccaccccc
gaggccgcgctggccgcgctggcgcaaggccccgccgacctggccttcgtcgacctgcgg
ctcggcacggccagcggaatggagctgttgccgcgcctcctggccgagtcgccccacctg
gacgtcgtgctcatcaccgcctacgccacgttcgacacggcggtggaggcgatgcgacgc
ggggcacgggactatctgcccaagcccttcacgcccgcgcagattcgccacgcggtggag
aaggcgcggcggcaccaggagctggcatcgcagttggagaacctggaggggcagctttcc
caggcggtgccggaggccacgttggagacagcctcgcccgcgatgcacgcggccatcggg
ctgttgacgcgcgcggcggcgtccgacgcggcggtgctgctgcggggagagagtggcacc
ggcaagggggtgctcgcccgcgcgctgcattcgatgagtgctcggcggcgccggcctttc
gtcaccgtcaactgtcccacgctgtccgagcaactgctggccagcgagctgttcggccac
gtgcgcggcgcgttcaccggcgcggtgaaggaccagccaggacgcgtggaggcggcggaa
gggggcacgctgttcctggatgaaatcgcggagatgagtccggggctccaggcgcaactg
ctgcgcttcctccaggagaagcagttcgaacggctgggcgagggacgcacgcgcaaggcg
gacgtgcgggtggtggcggcgacgaatcgggacctggagaaggacgtggccgaggggcgc
ttccgggaggacctgctctaccggctgaacgtcatcgaggtgaagctgccgtcgctgcga
gagcggccggaggacctgctttcgctggcccggcgcttcgtctccttcttcgctcgcgcg
gcgcagcgcccaccgccggagctgtcgcccgcgacggagaagatgctgttggcctatggg
tggccgggcaacgtgcgcgagctgcggaatgcaatggagcgagcgctcatcgtctggccc
gcggaggtgctggagccgcaggcgttccccgaccgcatcgccgcggcggggagtccggtg
atgaccctgggcgggccgcacacgttggaggacatcgagcgcgagcacgtgctgcgcgtc
atggcctcggcgcccacgttggatgaggcagcgcgggtgctgggcatcgacgcgtccacg
ctgtggcggaagcggaagaagtacgagtcgggcgagggctga

DBGET integrated database retrieval system