KEGG   Myxococcus xanthus: MXAN_0190Help
Entry
MXAN_0190         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Penicillinase_R TrmB FUR HTH_20 L27
Motif
Other DBs
NCBI-ProteinID: ABF86806
UniProt: Q1DFV1
Position
complement(231829..232260)
Genome map
AA seq 143 aa AA seqDB search
MDPGNRVTEGSIMSETKLPRPTDGELAILRVLWARGDSTVREVHEALTRDEPEGTGYTTV
LKLMQIMTEKGLVERDESQRAHVYRPRATEQRTQRQLVTDLVDRAFGGSPARLAMQALSS
KKTRPEELAELRRLLDTLEGGEE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggatccaggcaatcgagtcacggaaggaagcatcatgagtgagacgaagctgccgcgt
cccacggatggagagctggccatcctgcgggtcctctgggcgcgtggcgacagcacggtg
cgcgaggtgcacgaagccctcacccgcgacgagcccgagggcaccgggtacacgacggtg
ctaaagctgatgcaaatcatgacggagaaggggttggtggagcgtgacgagtcccagcgc
gcgcacgtgtaccggccccgggccacggagcagcgcacccagcggcagttggtgacggac
ctggtggaccgcgccttcggtggctctccggcgcggctggcgatgcaggccttgtcgtcg
aagaagacgcgtcccgaggaactggcggagctgcgccggctgctcgacaccctggaagga
ggcgaggaatga

DBGET integrated database retrieval system