KEGG   Myxococcus xanthus: MXAN_0894Help
Entry
MXAN_0894         CDS       T00366                                 

Definition
(GenBank) putative farnesyltranstransferase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00900  Terpenoid backbone biosynthesis
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01130  Biosynthesis of antibiotics
Module
mxa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MXAN_0894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mxa01006]
    MXAN_0894
Enzymes [BR:mxa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     MXAN_0894
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     MXAN_0894
    2.5.1.29  geranylgeranyl diphosphate synthase
     MXAN_0894
Prenyltransferases [BR:mxa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   MXAN_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ABF88066
UniProt: Q1DDW8
Position
1019276..1020361
Genome map
AA seq 361 aa AA seqDB search
MALTLPDAQPPTGLLPLEQAWLQLVQTEVETSLAELFELPDEAGLDVRWTQALTQARAYT
LRPAKRLRPALVMAGHCLARGSAVVPSGLWRFAAGLELLHTFLLIHDDVADQAELRRGAA
PLHRMLAPGRAGEDLAVVVGDHLFARALEVMLGSGLTCVAGVVQYYLGVCRHTAAGQYLD
LDLGRAPLAEVTLFQTLRVAHLKTARYGFCAPLVCGAMLGGASSGLVEELERVGRHVGLA
YQLRDDLLGLFGDSNVAGKAADGDFLQGKRTFPVLAAFARATEAERTELEALWALPVEQK
DAAALARARALVESCGGRAACERMVVRASRAARRSLQSLPNPNGVRELLDALIARLAHRA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcactcacgcttcccgatgcgcagccgccgacgggcctgcttcctctggagcaggcc
tggctgcaactggtccagacggaggtggagacctcgctggcggagttgttcgagctcccc
gacgaggccggcctggacgttcgttggacacaggcactgacgcaggcccgggcgtatacc
ttgcggcccgccaagcggctccgccccgcgctggtgatggccggacactgcctggcgcgt
gggagcgcggtggtgccctccgggttgtggcgcttcgccgcggggctggagctgctgcac
accttcctcctcatccatgacgacgtggcggatcaggcggagctgcggcggggcgccgcg
cccctccaccggatgctggcgccaggacgcgcgggcgaggacctggccgtggtggtgggg
gaccacctcttcgcgcgcgccctggaggtcatgctgggctcggggctgacgtgcgtcgcg
ggcgtggtgcagtactacctgggcgtgtgccgtcacacggcggccgggcagtacctggac
ctggacctgggccgcgcgccgctggcggaggtgacgctcttccagacgctgcgcgtggcg
catctcaagacggcgcgctacggcttctgcgccccgctggtgtgcggggccatgctcggc
ggtgccagcagcggcttggtggaggagttggagcgcgtgggccgtcacgtcggtcttgcc
taccagcttcgggacgatttgctgggcctttttggtgattcgaacgtcgctggcaaggcc
gctgacggcgacttcctccaaggcaagcgaacctttccagtgctggccgccttcgcgcgc
gccaccgaggccgagcgcacggagctggaggcgctgtgggcgctgccggtggagcagaag
gacgccgccgcgctggcgcgggcccgcgcgctggtggagtcctgcggaggccgggccgcg
tgtgagcgcatggtggtgcgtgcctccagggccgcccgccgctcgttgcagtcgctgccc
aatcccaacggtgtgagagagctgctcgacgcgctcatcgcccggctggcccaccgcgcc
gcctga

DBGET integrated database retrieval system