KEGG   Myxococcus xanthus: MXAN_0949Help
Entry
MXAN_0949         CDS       T00366                                 

Definition
(GenBank) AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00010  Glycolysis / Gluconeogenesis
mxa00620  Pyruvate metabolism
mxa00640  Propanoate metabolism
mxa00680  Methane metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_0949
   00620 Pyruvate metabolism
    MXAN_0949
   00640 Propanoate metabolism
    MXAN_0949
  Energy metabolism
   00680 Methane metabolism
    MXAN_0949
Enzymes [BR:mxa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MXAN_0949
Lipid biosynthesis proteins [BR:mxa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MXAN_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Peptidase_C28
Motif
Other DBs
NCBI-ProteinID: ABF89057
UniProt: Q1DDR3
Position
1089438..1091105
Genome map
AA seq 555 aa AA seqDB search
MVSSAQESATMPLSPPRNMKDYEATRRDFRWERPEHFNFAADVIDRHAAERPEALALLWS
DEAGQARRFTWEDLRRRSLHAARFLTEQGLRRGDRVFIMMPRVPEWWFLVLGCIRVGIVF
MPGTPMLTPKDIRYRLEVAEAQAVIADVSCLERFDGLVGTAGKVRTWVSVGEGAPSPWGR
YVSGVAEANAGAAFEPTRADAPLLIYFTSGTTGMPKMVLHTQASYGQGHVITGRYWLDLT
PEDRHLTLSDTGWAKCAWGKLFGPWSQGACNVVYDFRGRFEPAKLLKVLETQKVTTFCAP
PTAWRALVLQDLKAFDLSSLRHTVSAGEPLNPEVIDTWKDATGLHIHEGYGQTETVMIVG
MFPSMAPRVGSMGKPSPGFTVSVIDDQGQEVADGQEGDIAVRVAPERPVGLFQGYLGDDA
ANAACRRGDWYVTGDRAVRDADGYFWFVGRADDVIKTSGYRVGPFEVESALLEHDAVAES
AVIGVPDEKIGQRVKAFVVLAPGHTASPVLAQALQEHVKRTTAPYKYPREIEFVTELPKT
VSGKIRRAELRTTRT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttggtttcttccgcccaggagtcggccaccatgcccctgtcaccccctcggaacatgaag
gactacgaggccacccgccgggactttcgctgggagcggcccgagcacttcaacttcgcg
gccgacgtcatcgaccggcacgccgccgagcgcccggaggcgctggccctgctgtggtcc
gacgaagccgggcaggcgcggcgcttcacgtgggaggacttgcggcggcgctcgctgcac
gcggcccgcttcctgacggagcaggggcttcgccggggggaccgggtcttcattatgatg
ccgcgcgtgccggagtggtggttcctggtgctgggctgcattcgcgtgggcatcgtcttc
atgccgggcacgcccatgctcacgccgaaggacatccgttaccggttggaggtggcggag
gcccaggcggtgattgcggacgtgagctgcctggagcgcttcgacggcctggtggggacg
gccggcaaggtccgcacctgggtgtcggtgggcgagggcgcgccgtctccgtgggggcgc
tacgtgtccggcgtcgcggaggcgaacgcgggcgcggccttcgagcccacgcgcgcggat
gcgccgctgctcatctacttcacgtccggcaccacgggcatgccgaagatggtgctgcac
acgcaggccagctacgggcaggggcacgtgattaccggccgctactggctggacctgacg
ccggaggaccggcacctgacgctcagcgacaccggctgggccaagtgcgcgtggggcaag
ctcttcggcccgtggagtcagggcgcgtgcaacgtcgtctatgacttccgtggccgcttc
gagcccgcgaagctgctgaaggtgctggagacgcagaaggtcaccaccttctgcgcgccg
cccaccgcgtggcgggcgctggtgctccaggacttgaaggccttcgacctgtcctcgctg
cggcacacggtgagcgcgggcgagccgctcaatccggaagtcatcgacacgtggaaggat
gccaccgggctgcacatccatgagggctacgggcagacggagacggtgatgattgtgggc
atgttcccctccatggcgccgcgcgtgggttccatgggcaagccgtccccgggcttcacg
gtgagcgtcatcgacgaccagggccaggaggtggcggacgggcaagagggggacatcgcg
gtgcgcgtggcgcccgagcggcccgtggggttgttccagggctatctcggggacgacgcg
gccaacgcggcgtgccggcgtggtgactggtacgtgacgggagaccgggccgtgcgcgac
gcggacggctacttctggttcgtgggacgcgcggatgacgtcatcaagacgtcgggctac
cgcgtggggcccttcgaggtggagtccgcgctgctggagcacgacgcagtggcggagtcg
gccgtcatcggtgtgccggacgagaagattggccagcgggtgaaggccttcgtggtgctg
gcgccggggcatacggcatccccggtgctcgcgcaggcgttgcaggagcacgtgaagcgg
acgacggcgccctacaagtacccgcgcgaaatcgagttcgtcaccgagctgcccaagacg
gtgagcgggaagattcgccgcgcggagctgcgcaccacgcggacgtag

DBGET integrated database retrieval system