KEGG   Myxococcus xanthus: MXAN_1425Help
Entry
MXAN_1425         CDS       T00366                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00040  Pentose and glucuronate interconversions
mxa00052  Galactose metabolism
mxa00500  Starch and sucrose metabolism
mxa00520  Amino sugar and nucleotide sugar metabolism
mxa01100  Metabolic pathways
mxa01130  Biosynthesis of antibiotics
Module
mxa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MXAN_1425 (galU)
   00052 Galactose metabolism
    MXAN_1425 (galU)
   00500 Starch and sucrose metabolism
    MXAN_1425 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MXAN_1425 (galU)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MXAN_1425 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABF93008
UniProt: Q1DCE1
Position
1677411..1678313
Genome map
AA seq 300 aa AA seqDB search
MASKTSKVEPLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTPTLQYIVEEAVSAGIED
VVLINGRGKGAIEDHFDIGFELETTLRARGKDSEADKLRAIADLVRVVSIRQKEPKGLGH
AVLCAKSVIGDEPFGVLLGDDMIDAEEPGIRQLARVYRQYNQAVIALMEVPESETHMYGI
AAGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLPPDIFPILENQTPGVGGEIQLTD
GLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAYALKRPDLRAGLLEYMREVVKTEKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaaacctcgaaggtagagcccctcatccgcaagtgtgtcatcccggcagcc
ggcctgggcacgcgcttcctgccggcgaccaaggcggttcccaaggagatgctgcctatc
gtcgatactccgacgctccagtacatcgtggaagaggcggtatccgccggcatcgaggat
gtcgtcctcatcaatggccgcggcaagggcgccatcgaggaccacttcgacatcggcttc
gaactggagacgacgctgcgtgcgcgcggcaaggattccgaggccgacaagctgcgcgcc
atcgcggacctcgtgcgcgtcgtcagcatccgtcagaaggagcccaagggactgggccac
gcggtgctgtgcgccaagagcgtcatcggcgacgagcccttcggcgtgctgctgggcgac
gacatgattgatgccgaggagccgggaatccgccagctcgctcgcgtgtaccgccagtac
aaccaggcggtcatcgcgctcatggaagtgccggagagtgagacgcacatgtacggcatc
gccgcgggcacggacctgggtgatggcgtcatgcgcatcgaccgcatcgtggagaagccg
aagaagggcactgcgccctccaacctcgccgtcatcggccgctacgtgctgccgcccgac
atcttccccatcctggagaaccagacgccgggtgtgggcggcgaaatccagctcaccgac
ggcctggccacgctccagcagtcgaaggggctgctcggctaccgcttcaagggtcagcgc
tatgacgcgggcgacaaggtggggtacctgaaggccaacatcgcctacgcgctcaagcgt
ccggacctgcgtgccgggctgctcgagtacatgcgtgaagtcgtgaagacggagaagccg
tga

DBGET integrated database retrieval system