KEGG   Myxococcus xanthus: MXAN_1536Help
Entry
MXAN_1536         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MXAN_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABF87049
UniProt: Q1DC35
Position
1805139..1805525
Genome map
AA seq 128 aa AA seqDB search
MSSSAITDGIRITVKPAYWPERSAPESGQFAFMYTVEIANEGDAPAQLKARHWVITDATG
KVEEVRGEGVVGRQPHLGPGERFEYTSWAMLRTPFGTMRGTYDMVRPDGTHFEARIAEFA
LTLPNSLH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagcgccatcaccgacggcatccgcatcaccgtgaagcccgcctactggccg
gagcgcagcgctccggagtccgggcagttcgccttcatgtacacggtggagattgccaac
gagggcgacgcgccggcgcagctcaaggcgcgccattgggtcatcaccgatgccacgggc
aaggtggaagaggtgaggggcgagggcgtggtgggccgccagccccacctggggcccgga
gagcggttcgagtacacgagttgggccatgctgcgcacgcccttcggcaccatgcgcggc
acctatgacatggtgcggccggacggcacgcacttcgaagcgcgcatcgccgagttcgcg
ctcacccttcccaactccctgcactga

DBGET integrated database retrieval system