KEGG   Myxococcus xanthus: MXAN_1994
Entry
MXAN_1994         CDS       T00366                                 

Gene name
rpsI
Definition
(GenBank) ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
mxa  Myxococcus xanthus
Pathway
mxa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MXAN_1994 (rpsI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mxa03011]
    MXAN_1994 (rpsI)
Ribosome [BR:mxa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    MXAN_1994 (rpsI)
  Bacteria
    MXAN_1994 (rpsI)
  Archaea
    MXAN_1994 (rpsI)
SSDB
Motif
Pfam: Ribosomal_S9 Flg_hook
Other DBs
NCBI-ProteinID: ABF91068
UniProt: Q1DAU4
Position
2328225..2328626
AA seq 133 aa
MPINQELGFYATGRRKEATARVWIRPGTGLVTINGRELNEYFGRETSKMILNQPLEILEQ
KGKVDVTVNVKGGGLSGQAGAIRHGIARALCSFNPEFRPALKKAGFLTRDARAVERKKYG
QPGARRRFQFSKR
NT seq 402 nt   +upstreamnt  +downstreamnt
atgcccatcaaccaagagctcggtttctacgccaccggccgccgcaaggaggccaccgcc
cgcgtctggattcgtcctggcactggccttgtcaccatcaacggccgcgagctgaacgag
tacttcggccgtgagacgtccaagatgatcctcaaccagcccctcgagatcctcgagcag
aagggcaaggttgacgtgacggtcaacgtcaagggtggcggtctctccggccaggccggc
gccatccgtcacggcatcgcccgtgcgctgtgctccttcaacccggagttccgtccggcg
ctgaagaaggccggcttcctcacccgcgatgctcgcgcggtcgagcgtaagaagtacggc
cagccgggcgcgcgtcgccggttccagttctccaagcgctaa

DBGET integrated database retrieval system