KEGG   Myxococcus xanthus: MXAN_2043Help
Entry
MXAN_2043         CDS       T00366                                 

Definition
(GenBank) nucleotidyltransferase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00051  Fructose and mannose metabolism
mxa00520  Amino sugar and nucleotide sugar metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MXAN_2043
   00520 Amino sugar and nucleotide sugar metabolism
    MXAN_2043
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MXAN_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Motif
Other DBs
NCBI-ProteinID: ABF92019
UniProt: Q1DAQ1
Position
2372511..2373539
Genome map
AA seq 342 aa AA seqDB search
MKAMVLCAGLGTRLRPLTERWPKPAMPFLGQPLLRYHLAVLKAAGVTAVGINTHHLPDTM
EAVARAECARAGLPLHVVNEPVIQGTGGGIRGLRDFLSDGDFIVFNGDILYPVDLRPVVA
LHQASGALATMVLQPMPAGETYAAVELDAEGRVRRIAGHGPGGEGLSPWHFTGVHVMSPR
VFDFMSPRGEEDINRGVYVRAMEAGQMVRGVRVDGYWSDLGTPSRYLATVQDVLAGHVRL
EWLGADSPLAGTVRGASGTWAHAEARLDGTAEGPVYLGRGSAVAAGAAVGPGVSLEPGAK
VAAGARLSRATVFEDTEVSSGESLSEVLAWGAHRIAAPLKGR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatggtcctctgcgcgggcctgggcacgcgcctgcgcccgctcaccgaacgc
tggcccaagccggcgatgccattcttgggacagccgctgctgcgctaccacctggcagtg
ctgaaggccgcgggcgtgacggcggtgggcatcaacacccaccacctgccagacaccatg
gaggcggtggcccgcgccgagtgcgctcgcgcggggctgccgctgcacgtggtgaacgag
cccgtcatccagggcaccggcggcggcatccgcggcctgcgggacttcctgtcggacggc
gacttcatcgtcttcaacggcgacatcctctacccggtggacctgcggccggtggtggcc
ctgcaccaggcgtccggcgcgctggccaccatggtgctgcagcccatgccagcgggggag
acgtacgccgcggtggagctggacgcggaagggcgcgtgcgccgcatcgccggccacggc
cctggaggtgaaggcttgtcgccgtggcacttcaccggcgtgcacgtgatgtcgccgcgc
gtcttcgacttcatgtcgccgcgaggtgaggaggacatcaaccgcggcgtctatgtccgt
gccatggaggccgggcagatggtgcgcggcgtgcgggtggacgggtactggtccgacctg
ggcacgccgtcgcgctacctcgccaccgtgcaggacgtgctcgccgggcacgtgcggctg
gagtggctgggcgcggactcaccgctggcggggaccgtgcgcggcgcgagtggcacctgg
gcgcacgcggaggcccgcctggacggcacggcggagggcccggtgtacctggggcggggc
agcgcggtggccgccggagccgccgtggggccgggcgtgtcgctggagccgggcgcgaag
gtggctgcgggggcgcggctctcgcgagccaccgtcttcgaggacaccgaggtgtcctcc
ggggagtcgctctccgaggtgctcgcctggggcgcgcaccggattgccgcgccgctgaag
gggcgctga

DBGET integrated database retrieval system