KEGG   Myxococcus xanthus: MXAN_2657Help
Entry
MXAN_2657         CDS       T00366                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00860  Porphyrin and chlorophyll metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
Module
mxa_M00121  Heme biosynthesis, glutamate => heme
mxa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MXAN_2657 (hemD)
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MXAN_2657 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 MEDS
Motif
Other DBs
NCBI-ProteinID: ABF89601
UniProt: Q1D8Z7
Position
3099288..3100058
Genome map
AA seq 256 aa AA seqDB search
MERRLEGKRVLVTRPRERAEELCFLLEDEGAEVLSVPLLELHPPEDPRPLASAAEHIQRY
TWVVFASPTGVDALMEALREAGTQDRIQRVKVATVGPRTTRAAEGYGLVVVAEPSEGTGA
ALLNLIKDALQPGDEVLLPAAEEGRRELEDGLREYGLLVTRVTAYRATPAPLPPESLALL
DASPPDVVLFASPRTAEAFVEEAGRERLATARVVAIGPTTASALERLGVPAAAVAERPTP
ESLVDAAVLAVTSTVH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggcgacttgaaggcaagagagtcttggtgacgcgcccgcgtgagcgggccgag
gagttgtgcttcctcctggaggatgagggcgccgaagtgctgagcgtgccccttctggaa
ctgcatcctccggaggacccacgtccgctggcgtctgcggccgagcacatccagcgctac
acctgggtggtgttcgcgagcccgaccggcgtggatgcgctgatggaggccctgcgcgag
gcgggcacccaggaccggatacagcgggtgaaggtggccaccgtggggccgcgcacgacg
cgcgccgcggagggctacggcctggtcgtggtggccgaaccttccgagggcacgggcgcg
gccctgctcaacctcatcaaggatgcgctgcaaccgggtgacgaagtcctgcttcccgcc
gccgaggaaggccggcgtgagctggaagacgggctgagagagtacggcctcctggtgacg
cgggtgacggcgtatcgcgccacgcccgcgcccctgccaccggagtcgctggccttactg
gatgcctcaccgccggacgtcgtgctcttcgcttcgccgcgcacggccgaggccttcgtg
gaagaggccggacgcgagcgcctggccaccgctcgggtggtggcaatcggtccgacgacg
gcgtccgccctggagcggctgggcgtgcccgcggcggccgtcgcggagcggccgacgcca
gagtccctggtggatgccgccgtgctcgcggtgacgagcaccgtgcactga

DBGET integrated database retrieval system