KEGG   Myxococcus xanthus: MXAN_3564
Entry
MXAN_3564         CDS       T00366                                 

Name
(GenBank) peptidase, M36 (fungalysin) family
Organism
mxa  Myxococcus xanthus
SSDB
Motif
Pfam: Peptidase_M36 PKD_4 PA Big_9 REJ Peptidase_M6 PKD FTP Cadherin_4 Cadherin_5 LEA_2
Other DBs
NCBI-ProteinID: ABF88441
UniProt: Q1D6G9
Position
4147966..4153308
AA seq 1780 aa
MEFPHVRRLVATLSGLALVLSGTSSVARTLPNYDALQDAKPAGRAAAGFKPVNSSLKGAR
VAHKDSLTGSPTFIWTHPTSEQTKLRGEYAKMSPAKAALAQISAHAPLYGLASFEAAGAT
VTNVSTNTQGVKVVTLAQESSGIEVFRQSLKVLLNKHNQVVAISGSLSKHGSAEIPKGKA
RFTVPATEAIAVAYKDLTGAALDRNLLTRVSDAKKGDKYSHFTLASYARPLEEGFVIPAR
AKQVYFPLPGKLVPAYYVEINTSRANSVDSDYFAYVISATDGQLLMRNNLTAHAEFSYRV
FSDTTPPYTPHDGPIGSGGTPHPTGNPDGYQSPYVPANLITLESLPFSRNDPWLPDGATE
TQGNNVDAYADLADPDYYSPGDLRASVTAPGVFDRIIDFGIQPNANNEQIAAATTSLFFL
NNWLHDWYYDAGFDEASGNAQHDNFGRGGVGGDRLHAQAQDYSGTDNANMRTPADGASPR
MQMYLFAGARNSRLTANAPAEVAGDYEGGVSSTFGPQTFNVTGDVVAALDAANTAGPTDR
DGCTALTNAAEVVGKIAIIDRGTCGFVDKVTNAQNAGAIGVIIHDNVAGPTIDLGGDSTT
ITIPTLRVNLDDGNVLRSGLPALNVTLWRGPTAWIDGTIDNAIVAHEWGHYISNRLVANS
SGLVNNQGRSMGEGWGDFTALLMMVRAEDINVPSNANWNGAYAAAGYATRADANSEFFGI
RRGTYSSDQTKNALSFRHIMDGVALPTGVPFNGNTGQPNSQVHNSGEIWATMLWECYTSL
LRAHPFQEAQDRMKSYLVNGYKLTPAAPTYLEARDAVIAAAYANDPADAERFWTAFAKRG
AGVGAVAPDRYSTNHAGVVESFVVGSAIQIVSAEFIDDVEAGSCDLDGILDNGETGRIEV
TVRNAGALPASASSVNLSSAFSGLEFGNGGQASFPAIPVFGTATVSIPVSLTGATGQQDV
TIDIAARDAGQAIPGDITDSIILTTHFDERENSSNIEDVQISPSKLPWETEYDEALTPAA
FSVVTFPDGNRTFYAENTASYADVRLISPELHVSATEPFVINFMHAWDFEDDYDGATVEI
SEDGGQTWVDIGDPIHNSVLETYPGNLNPLAGKPALSSYNPQFPGMLPATIDLGTAYAGK
TVQVRFRVGTDESGGYTGWLLDDLEFNGITNTPFATIAPEDGVCVNPWPIANAGPDRSIA
PGELVSLYGSAADPEGQPVTFTWAQTSGPAVTLAGANTLNPSFTAPQVTESTALVFTLTV
SDGVKTSTDSVTVTVALPNNPPTVNAGLDGIVEERAEYTLSGSASDADGNALTYLWTQVS
GTPVAVKDYTTPTATFIAPEVTLDESLVFRLTVSDGIATVNDTVTVTVTNANRAPIVSDT
SVAFAAGTVTVTASAVDPDGDALSYSWEQTGGSTVAINGADTSAISFATPVPGSYEFTVT
ATDGSASASKAVPVTIIDGSLPANSAPTVNAGIDATANAGDVVTLSGSASDAEGDTLTYH
WEQIGGTDVTLTGADTLTPSFTAPSTASGTTLGFILTVSDGTSTTSDAVRVIVAADPGAN
PSNTAPEADAGESAIVAEGATVTLNGTATDADGDTLVIVWTQIGGTPVTLSDASSLTPTF
TAPASSDPLTFLLMVSDGTATVVDVTSISVTEENVAPVASARAVLSGNQTSATLDGSASS
DANGDVLTYRWTQVSGPNATISGADQAVAVVNLPDLDDKTASFSFRLTVKDSAGTESSTT
VQFSARNGGDSGGCSATGAGAPVGMIGLALLGLLRRRRLN
NT seq 5343 nt   +upstreamnt  +downstreamnt
atggagtttccccacgtgagaaggttggttgccacgctgtccgggcttgccctggtactg
tccggtaccagttccgtcgcccggacgctgccgaactatgatgcactccaggacgcgaag
cccgcgggccgtgccgccgcgggattcaagccggtcaacagcagcctgaagggggcgcgg
gtcgcccacaaggactcgctgaccggttccccgacgttcatctggacgcacccgacctcg
gagcagacgaagctccgtggcgagtacgcgaagatgtctcccgccaaggcggcgctggcg
cagatttctgcccacgctcctctctacggtctcgcttcgtttgaggccgcgggcgcgacg
gtcaccaacgtcagcaccaacacgcagggcgtgaaggtcgtgacgctggcccaggagtcc
tcgggaatcgaggtcttccgccagtcgctgaaggtgctgctgaacaagcacaatcaggtg
gttgccatctccggcagcctctccaagcacggttccgcggagatccccaagggcaaggcg
cgcttcaccgtgcccgcgaccgaggcgatcgccgtggcctacaaggacctcacgggcgcc
gcgctggaccgcaacctgctcacccgcgtgagcgacgcgaagaagggcgacaagtactcg
cacttcacgctggccagctacgcgcgtccgctcgaggaggggtttgtcatccccgcccgc
gcgaagcaggtctacttcccgctgcctggcaagctggtccccgcgtactacgtggagatc
aacacgagccgcgcgaacagcgtggactcggactacttcgcgtacgtcatctccgccacc
gacggtcagttgctgatgcgcaacaacctgacggcgcacgcggagttcagctaccgcgtg
ttctcggacacgacgccgccgtacaccccgcacgacggtccgatcggcagcggcggtacg
ccgcacccgaccggcaacccggacggctaccagtcgccgtacgttccggcgaacctgatc
accctcgagagcctcccgttcagccggaacgatccctggctgccggacggcgcgacggag
acgcagggtaacaacgtcgacgcgtacgcggacctcgccgatccggactactacagcccc
ggcgacctccgtgcttccgtcacggccccgggcgtgttcgaccggatcatcgacttcggc
atccagccgaacgccaacaacgagcagatcgccgcggcgacgacgagcctgttcttcctg
aacaactggctccacgactggtactacgacgccgggttcgacgaggcctccggcaacgcc
cagcatgacaacttcgggcgtggcggcgtgggcggtgaccgtctgcatgcgcaggcgcag
gactacagcggcaccgacaacgccaacatgcgcacgccggcggacggtgcgtcgccgcgc
atgcagatgtacctgttcgccggggcgcgcaactcgcgtctgacggcgaacgctccggcg
gaggtcgcgggtgactacgagggtggcgtctcctccaccttcggtccgcagaccttcaac
gtcaccggcgacgtggtcgcggcgctggatgccgccaacaccgccggcccgacggaccgt
gacggctgcaccgcgctgaccaacgcggccgaggtcgttggcaagatcgccatcatcgac
cgcggcacctgcggcttcgtcgacaaggtgaccaacgcgcagaacgcgggcgccatcggc
gtcatcatccacgacaacgtcgcgggtcccacgatcgacctgggcggcgactccaccacc
atcaccatccccacgcttcgcgtgaacctggatgatggcaacgtgctgcgcagcggcctg
ccggcgctcaacgtcaccctgtggcgtggcccgaccgcgtggatcgacggcaccatcgac
aacgccatcgtggcgcacgagtggggccactacatcagcaaccgccttgtcgcgaactcg
tccggtctggtgaacaaccagggccgctcgatgggcgagggctggggtgacttcaccgcc
ctgctgatgatggttcgcgccgaggacatcaacgtcccgtccaacgcgaactggaacggc
gcctacgccgccgcgggctacgccacgcgcgcggacgcgaactccgagttcttcggtatc
cgccgtggcacgtactcgtcggaccagaccaagaacgcgctgtcgttccgtcacatcatg
gacggcgtggcgctgcccacgggtgtgccgttcaacggcaacacgggtcagccgaactcg
caggttcacaactccggcgagatctgggcgacgatgctgtgggagtgctacacgtcgctg
ctccgcgcgcatccgttccaggaggcgcaggaccggatgaagagctacctggtgaacggg
tacaagctcacgccggcggcccccacgtacctggaggcgcgtgacgccgtcatcgcggcg
gcctacgccaacgacccggcggacgccgagcggttctggacggccttcgccaagcgcggc
gcgggcgtcggcgccgtggctccggaccgctactccacgaaccacgccggtgtcgtggag
agcttcgtggtcggttcggccatccagattgtgtcggccgagttcatcgacgacgtcgag
gctggctcgtgcgacctcgacggcatcctggacaacggtgagacgggccgcatcgaggtc
accgtgcgcaacgcgggcgcactgcctgcgtccgcctccagcgtcaacctgtcctccgcc
ttctcgggtctcgagttcggcaacggtggtcaggcaagcttcccggccatccccgtgttc
ggtacggccacggtctccatcccggtctcgctcacgggcgcgacgggccagcaggacgtg
accatcgacatcgcggcgcgtgatgcgggccaggcgatccccggcgacatcacggacagc
atcatcctcacgacgcacttcgacgagcgtgagaactcctccaacatcgaggacgttcag
atctccccgtccaagctgccttgggaaaccgagtacgacgaggccctgaccccggccgcg
ttcagcgtggtcacgttcccggacggcaaccgcacgttctacgcggagaacaccgcttcc
tacgccgacgttcgcctcatctcgcctgagctgcacgtcagcgcgaccgagcccttcgtg
atcaacttcatgcacgcttgggacttcgaggatgactacgacggcgccacggtcgaaatc
tccgaggacggtggccagacctgggtggacatcggcgatccgatccacaactcggttctt
gagacctacccgggcaacctgaacccgctggctggcaagcccgcgctgtccagctacaac
cctcagttcccgggcatgctccctgcgaccatcgacctgggcacggcctacgccggcaag
acggtgcaggtccgcttccgggtcggtacggacgagagcggcggctacacgggctggctg
ctggacgacctcgagttcaacggcatcacgaacactccgttcgccaccatcgcgcccgag
gatggcgtttgtgtgaacccctggcccatcgccaacgccggtccggaccggtccatcgcg
ccgggtgaactggtgagcctctacggttcggctgccgatccggaaggccagccggtgacc
ttcacctgggcacagacgtctggccctgcggtcaccctggcgggtgccaacaccctgaac
ccgtcgttcacggcgccgcaggttaccgagtccaccgcactggtgttcacgctgaccgtc
tccgacggcgtcaagacgtccacggactcggtgaccgtgacggtggcgctccccaacaat
ccgcccaccgtgaacgcgggcctcgacggcatcgtcgaggagcgcgctgagtacacgctg
agcggctccgccagcgatgcggatggcaatgccctcacgtacctgtggacccaggtctcc
ggtacgccggtggcggtgaaggactacaccacgccgacggcgacgttcatcgcgcccgag
gtcacgctggatgagtcgctggtcttccgtctgacggtcagcgacggcatcgccacggtg
aacgacacggtcaccgtgacggtcaccaacgcgaaccgcgcgcccatcgtctccgacacg
tccgtggccttcgccgcgggcactgtcaccgtgacggcctccgcggtcgacccggatggt
gacgcgctcagctacagctgggagcagacgggtggttcgacggtcgccatcaatggcgcc
gacacgtccgccatctccttcgccaccccggtcccgggttcgtacgagttcaccgtgacg
gcgacggacggctcggcctctgcctccaaggcggtgccggtgaccatcatcgatggttct
ctgccggcgaactctgcgccgaccgtgaacgcgggcatcgatgccacggcgaacgctggt
gacgtcgtgacgctcagcggctccgcgagcgacgccgagggtgacacgctgacgtaccac
tgggagcagatcggtggcacggatgtgaccctgacgggcgccgacaccctgacgccgtcg
ttcaccgcgccgagcacggccagcggtaccacgctcggcttcatcctgacggtcagcgat
ggcacctcgaccaccagcgatgccgtgcgcgtcatcgtggcggcggacccgggtgccaac
ccgagcaacactgctccggaagcggacgcgggcgagtcggccatcgtggcggagggcgcc
actgtgacgctcaacggcacggcgaccgacgctgacggtgacacgctcgtcatcgtctgg
acgcagatcggcggcacgcccgtgacgctgtctgacgcgtcctcgctgacgccgacgttc
accgccccggcctcctccgatccgctgaccttcctcctgatggtcagcgacggtacggcg
actgtcgtcgacgtgacgtccatcagcgtgaccgaggagaacgtcgcgccggtggcgtcc
gctcgcgcggtgctctctggcaaccagacgtcggccacgctcgacggctcggcttccagc
gacgcgaacggcgatgtgctgacgtaccgctggacgcaggtctccggcccgaacgcgacc
atctccggcgcggaccaggcggttgcggtcgtcaacctgcctgacctcgacgacaagacg
gcgtcgttctcgttccgcctgacggtgaaggactccgcgggcaccgagagcagcaccacc
gtgcagttctccgcccgcaacggcggtgacagcggtggctgctccgcgacgggcgcgggc
gctccggtcggcatgatcggcctggcgctgctcggcctgctgcgccgccgtcgtctgaac
tga

DBGET integrated database retrieval system