KEGG   Myxococcus xanthus: MXAN_3791Help
Entry
MXAN_3791         CDS       T00366                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00071  Fatty acid degradation
mxa00072  Synthesis and degradation of ketone bodies
mxa00280  Valine, leucine and isoleucine degradation
mxa00310  Lysine degradation
mxa00362  Benzoate degradation
mxa00380  Tryptophan metabolism
mxa00620  Pyruvate metabolism
mxa00630  Glyoxylate and dicarboxylate metabolism
mxa00640  Propanoate metabolism
mxa00650  Butanoate metabolism
mxa00900  Terpenoid backbone biosynthesis
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
mxa01212  Fatty acid metabolism
mxa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MXAN_3791
   00630 Glyoxylate and dicarboxylate metabolism
    MXAN_3791
   00640 Propanoate metabolism
    MXAN_3791
   00650 Butanoate metabolism
    MXAN_3791
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MXAN_3791
   00072 Synthesis and degradation of ketone bodies
    MXAN_3791
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_3791
   00310 Lysine degradation
    MXAN_3791
   00380 Tryptophan metabolism
    MXAN_3791
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MXAN_3791
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXAN_3791
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MXAN_3791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mxa04147]
    MXAN_3791
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MXAN_3791
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MXAN_3791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABF86970
UniProt: Q1D5V0
Position
complement(4555839..4557020)
Genome map
AA seq 393 aa AA seqDB search
MARDVVIVGAARTPIGAFQGALAKLTAPQLGAIAIKAALERAGVKPEAVQEVILGCVLTA
GVGQAPARQAAIFAGLPETVPATTLNKVCGSGLKAVSAGAQAIALGDADVVVVGGMESMS
NAPYISHTMRGGARMGNVEFKDAMIHDGLWDVYGNVHMGICAEECATTQDISRSQQDEYA
LESTRRAIQAQKEGLFKAEIVPVQIPGKKPEDVVTVSDDEGPRNAKPEKIPGLKPVFKKD
GTVTAANASSINDGAAALVLMSEERAKAEGRAILGRITGYAQAARKPVEFTIAPTDAINK
LLKKQGISAGDVDLWEINEAFAVVSIANNRLLGLDVSKVNVRGGAVALGHPIGASGARVL
VTLLQTMQDLDKKRGVASLCIGGGEGIALMVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgacgtcgtcatcgtgggcgcggcccgtacccccattggtgcctttcagggc
gcgctcgccaagctgacggccccgcagctgggcgcgatcgcgatcaaggcggcgctggag
cgcgcgggcgtgaagcccgaggccgttcaggaagtcatcctgggctgtgtgctcaccgcg
ggcgtgggccaggcgcccgctcgccaggcggccatcttcgccggcctgcccgagacggtt
cccgccaccacgctcaacaaggtctgtggctccggcctcaaggccgtcagcgcgggcgcg
caggccattgccctgggtgacgcggacgtcgtcgtcgtgggcggcatggagtccatgagc
aacgcgccgtacatcagccacacgatgcgtggcggcgcgcgcatgggcaacgtggaattc
aaggacgcgatgatccacgacggcctctgggacgtgtacggcaacgtccacatgggcatc
tgcgccgaggagtgcgccacgacgcaggacatcagccgctcgcagcaggacgagtacgcg
ctggagtccacgcgccgcgccatccaggcccagaaggaaggcctgttcaaggcggagatc
gtcccggtccagattccgggcaagaagccggaggacgtcgtcaccgtctccgacgacgag
gggccccgcaacgcgaagccggagaagattccgggcctgaagccggtgttcaagaaggac
ggcacggtgacggccgccaacgcgtcctccatcaacgacggcgccgcggcgctggtgctg
atgagcgaggagcgcgcgaaggccgagggccgcgccatcctgggccgcatcacgggctac
gcccaggcggcgcgcaagccggtggagttcaccatcgcgcccacggacgccatcaacaag
ctgctgaagaagcagggcatcagcgcgggtgacgtggacctctgggagatcaacgaggcg
ttcgcggtggtgtccatcgcgaacaaccggctgctcggcctggacgtgtcgaaagtgaac
gtgcgcggcggcgcggtggcgctggggcacccgattggcgcgtccggcgcgcgcgtgctg
gtgacgctgctgcagacgatgcaggacctggacaagaagcgtggcgtcgcgtcgctctgc
atcggcggcggcgagggcatcgcgctgatggtggagcgctga

DBGET integrated database retrieval system