KEGG   Myxococcus xanthus: MXAN_4217Help
Entry
MXAN_4217         CDS       T00366                                 

Definition
(GenBank) alpha keto acid dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00010  Glycolysis / Gluconeogenesis
mxa00020  Citrate cycle (TCA cycle)
mxa00620  Pyruvate metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
Module
mxa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_4217
   00020 Citrate cycle (TCA cycle)
    MXAN_4217
   00620 Pyruvate metabolism
    MXAN_4217
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MXAN_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N NQRA DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABF90075
UniProt: Q1D4N1
Position
complement(5176806..5178056)
Genome map
AA seq 416 aa AA seqDB search
MAIFEFKLPDLGEGVMEGELVKWHVKAGDSVKEDQVLAEVMTDKATVTVPAPKAGRVVKT
HGNEGDMAKVHQLLVTLEVEGAAPAQAGGHSEASAPAAAPVAGGHVGGAPASASKVLATP
VTRRMAREHGLDLASIAGTGPQGRVTKADVVAALEGGEKNVVAAPAEQKARPAAPAVSSG
AADERVPLRGLRKKIAEKMVRSKFTAPHFAFVEEVDATELVALRARLNAQLAAAGENIKL
NYLPFIIKATVAALKKFPHLNANFDEASQELVVRGEFNIGMAAATPDGLTVAVVKSADRL
TLAELARETARLGAAARDRKLKMEELTGGTFTISSLGQSGGLFATPIINHPEVGILGVHR
LKKRPAVVGDQVVVRDMMNLSLSCDHRVIDGSVAADFTYEIIKYLEKPDLLFLAMA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttcgaattcaagctccccgaccttggtgaaggcgtgatggagggtgagctg
gtgaagtggcacgtgaaggcaggggattccgtcaaggaagaccaggtgctcgccgaggtg
atgacggacaaggccaccgtcaccgttcccgctcccaaggcgggccgtgtcgtgaagacg
catggcaatgaaggcgacatggcgaaggtgcaccagctcctcgtcaccctggaggtggag
ggcgctgcgccggcgcaggccggtggtcattccgaggccagcgcgccagcggcggcgccc
gtggcgggtggccatgtcggtggtgcgcctgcctcggcgtccaaggtgctggccacgccg
gtgacgcggcggatggcgcgcgagcacgggctggacctggcgtcgattgccggcacgggg
ccacagggccgcgtgacgaaggcggatgtggtggcggcgctggagggtggcgagaagaac
gtcgtcgcggctccggccgagcagaaggcgcgtcccgcggctcctgccgtcagctcgggc
gcggcggacgagcgcgttccgcttcggggcctgcgcaagaagatcgcggagaagatggtg
cggtcgaagttcacggcgccgcacttcgcctttgtcgaggaagtggacgccacggagctg
gtggccctgcgcgcgcggctgaacgcgcagttggcggcggccggtgagaacatcaagctc
aactacctgccgttcatcatcaaggcgacggtggcggcgctgaagaagttcccgcacctg
aacgcgaacttcgacgaggcgtcgcaggagctggtggtccgcggcgagttcaacatcggc
atggcggcggcgacgccggacggcctcaccgtggcggtggtgaagagcgcggaccggctg
acgctggccgagctggcgcgtgagacggcccgcctgggcgccgccgcgcgtgaccgcaag
ctgaagatggaggagctgacgggcggcaccttcaccatcagctcgctggggcagagcggc
ggcctgttcgccacgcccatcatcaaccaccctgaagtgggcatcctgggcgtgcaccgc
ctgaagaagcgcccggcggtggtgggggaccaggtcgtcgtgcgcgacatgatgaacctg
tcgctgtcgtgcgaccaccgcgtcatcgacggctcggtggcggcggatttcacgtacgaa
atcatcaagtacctggagaagccggacctgctgttcctggccatggcgtga

DBGET integrated database retrieval system