KEGG   Myxococcus xanthus: MXAN_4806
Entry
MXAN_4806         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mxa02044]
    MXAN_4806
Secretion system [BR:mxa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MXAN_4806
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N TPR_16 TPR_19 TPR_21
Other DBs
NCBI-ProteinID: ABF88309
UniProt: Q1D306
Position
6013836..6015860
AA seq 674 aa
MPPSLEQLRERALPWAEPVPGASPAGVQAKHEPAYEAVALEVAKLESPASNAVRWDDVVE
GASELLKHTTKDLWLASYMAYGLYATRGLDGAATGTAVLAEVTERYWQDLFPEAKRLRGR
ANAVAWFVDRLGRILPTVDQASVSAEPLDALAVAVKRLAQLSRERFSDMAPAFGPLQDAI
ARLRAGLPEPEPESVPDGRTASSEDADASQPPVDGTASSQDEDTPSGEDGETVVRAADSA
NGTRPGAPSDSAETPTNGNGNRSAREAGNASANGKPAQANGAGNSAAPGKGNTAPGNPTA
KNAPAPAKISTAQGTAKASAASQGGASANGTPAPPRAAIEVPPLPELPAAPDLSSVEAIT
DFLRTVGGALLGAAGALRRASPEDPLSYRLNRMGLWLHLTQPPATDGNGRTQIHPLPDLL
GTKLETLEQNQRWGELLDESESALARHRFTLTLHRYSATALEGLGAAYAGARTALVQELA
IQLRRMTGVETLISTLGSPLTDDATQDWLRDHVLRASAPPPAPSAAVASVSTTLALGPLS
LGPSVHADSAALEAEARTLLEEGRVHEAVTRLQAAVAAASTGRARFISRLELARLCANAG
QLPLARAVYDALDEEVSAHALDTWEPALAAACLEGWLQTRTEAEKESGPVAVKFRNRYRR
LALLDSSATLRVGA
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgcctccctccctggaacagcttcgtgaacgtgccctcccctgggccgagcccgtgccg
ggggcgtccccggccggcgtgcaggcgaagcacgagcccgcatacgaggccgtcgcgctg
gaagtcgcgaagttggagtctccggccagcaacgccgtgcgctgggatgacgtcgtcgag
ggcgccagcgagctgctgaagcacaccaccaaggacctctggctcgcctcgtacatggcc
tatggcctgtatgccacgcgaggcctggacggcgcggccaccggcacggccgtgctcgcc
gaggtgacggagcgctactggcaggacctcttcccggaggcgaagcggctgcgcggccga
gccaacgccgtggcctggttcgtggaccggctgggccgcatcctgcccaccgtagaccag
gcctccgtgagcgcggagcccctggatgcgctggcggtcgcggtgaagcgcctggcccag
ctctcacgcgagcggttctccgacatggcccccgcgttcgggccgctccaggatgccatc
gcccggctccgcgccggactccccgagcccgaacccgagagcgtaccggatggacgcacc
gcgtcctcggaggacgcagacgcctcgcagccgccggtggatgggactgcgtcgtcccag
gacgaggacaccccgtccggcgaggatggagagaccgttgtgcgcgcggcggactccgcg
aatggcacgcggccaggagcgccttcggacagcgctgaaacgcccacgaacggcaatggc
aaccgctccgctcgggaggcgggcaatgccagcgccaacggcaaacctgctcaagccaac
ggtgctggaaacagcgccgccccgggtaaaggcaacaccgccccgggcaatcccacggcg
aagaacgcccccgccccggccaaaatcagcaccgctcagggcaccgccaaagccagcgca
gccagccagggcggcgcctccgccaacggcacacccgcaccaccgcgcgccgccatcgaa
gtcccgcccctccccgagcttcccgccgccccggatctgtccagcgtggaggcgatcacc
gacttcctgcgcaccgtgggcggcgcgctgctgggagccgcgggcgcgctgcgccgggcc
agccccgaggatccgctctcctaccgcctcaaccgcatgggcctgtggttgcacctgacc
cagccgcccgccacggatggcaatggccgcacccagattcacccactgccggacctgctg
ggaaccaagctggagaccctggagcagaaccagcgctggggcgagctgctggacgagtcc
gagtcggccctggcccgccaccgcttcacgctgacgctccaccggtacagcgccaccgcc
ctggaggggctgggtgccgcgtacgccggggctcgcaccgcgctggtacaggaattggcc
atccagctccgccgcatgaccggcgtggagacgctcatctccaccttgggaagcccgctc
acggacgacgccacccaggactggctgcgcgaccacgtcctccgcgcgagcgcgccccca
cccgccccttccgccgccgtggcgtcggtgtccacgaccctggcgctggggcccctgtcg
ctgggcccgtctgtccatgccgacagcgcggcgctggaagccgaagcccgcacgttgctg
gaggaaggccgtgtccacgaagctgtcacccggttgcaggccgccgtcgccgccgccagc
accggccgcgcccgcttcatctcccggctggagctggcgcggttgtgtgccaatgcgggc
cagttgccgctcgcgcgcgccgtctatgacgcgctggacgaagaggtctccgcccacgcg
ctcgacacctgggagccagcgctcgccgccgcgtgtctggaggggtggctgcaaacccgc
accgaagccgaaaaggagtctggaccggtggcagtgaaatttcgaaaccggtatcgtcgt
ctagcgttgctggactcttccgccacgctgcgcgtcggcgcttga

DBGET integrated database retrieval system