KEGG   Myxococcus xanthus: MXAN_4811
Entry
MXAN_4811         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mxa02044]
    MXAN_4811
Secretion system [BR:mxa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MXAN_4811
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABF86980
UniProt: Q1D301
Position
6019075..6020826
AA seq 583 aa
MFSKYYLSELSYLREMGRAFGLANPSVAGLLVERGADPDVERLLEGFAFLAARIRERVDD
DVPELVHGLTELLLPHYLRPLPASTIVEFTPHLRALRGRSRLAAGAEVASQPIDGTSCVF
RTTTDVDLLPVQLTDALLDRSSITAPVLRLYFQTTEQGRAEVLREQGLRLFIHADLSAAS
VVLLWLLRYCRQVRVRGASGQGDGIKLPVNAIQPVGFHRDFKLLPWPRASEGYRHLQEYL
TLPEKFLFFEVRGLDAAAGLKEDRFEIAFHLERPPPLDARIHREMFRLHCAPVVNLFSVP
ADPILHRTLDREHLLRASDLPPNHAEIYSVDSVTGLKAGRNERRVYRPFYEFTHTAGGDA
EQSFYRLRRAPSPLDEGIDTYITLETPRNIAPEVNAEEALSMDLTCTNRSLPSRLQVGDL
TASTSASPTQAKFKNISPVSRPARAPLGTELHWRLLSHLAINQHSLADAAALRRLMDLYN
FHSLTDNLAARASRLRINAIRAVETKPVTRFLEGAPLRGHRTRVDLDEENFMGVGDSFLF
GSVLEELLASHVTINSFNELSIRLHPSQTEFAWLPRNGSQTLL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgttcagcaagtattacctgagcgagctgtcgtacctgcgggagatgggacgggccttc
gggctggccaacccctctgtcgcgggcctgttggtggagcgcggcgcggacccggacgtg
gagcggctgctggagggcttcgcgttcctcgcggcccgcatccgcgagcgcgtggacgac
gacgtgccggagctggtgcacgggctcaccgagctgctgctaccgcactacctgcgcccg
ctgccggcctccaccatcgtcgagttcaccccgcacctgcgcgcgctgcgcggccgctcg
cggctggccgccggggcggaggtggcgtcgcagccgattgacggcaccagttgcgtcttc
cgcaccaccacggacgtggacctgctgccggtgcagctcaccgacgcactcctggaccgg
tcgtccatcaccgcgccggtgctgcgcctctatttccagacgacggagcagggccgcgcg
gaggtgttgcgcgagcaaggcctgcgcctgttcatccacgccgacctgtccgctgcgtcg
gtggtgctgctgtggttgctccgctactgccgccaggtgcgcgtgcgcggcgcgtctggc
cagggagacggcatcaagctgccggtgaatgccatccaaccggtgggcttccaccgggac
ttcaagctgctgccctggccgcgcgccagcgagggctaccggcacctccaggagtacctg
acgctgccggagaagttcctgttcttcgaggtgcgcgggctggacgccgccgccgggctg
aaagaggaccgcttcgagattgccttccacctggagcggccgccgcccctggatgcgcgc
atccaccgggagatgttccggctacattgcgcccccgtggtgaacctcttcagcgtgccg
gcggaccccatcctccaccgcacgctggaccgggagcacctgctgcgcgcgtccgacctg
ccccccaaccacgcggagatttactcggtggactcggtgacgggcctgaaggccggacgc
aacgagcggcgcgtctaccggcccttctacgagttcacccacaccgcgggcggggacgcc
gagcagtccttctatcggctgcgccgggcgccttcgccgctggacgaaggaatcgacacg
tacattacgctggagacgccgcggaacatcgcgccggaggtcaacgccgaggaagcgctg
tccatggacctgacgtgcaccaaccgctcgctgccctcgcggctgcaggtgggtgacttg
acggcatccacctccgccagccccacgcaggcgaagttcaagaacatctccccggtgagc
cggcccgcgcgcgcgccgctgggcaccgaactgcactggcggctcctgtcgcacctggcc
atcaaccagcactcgctggcggacgcggccgcactgcggcggctgatggacctgtacaac
ttccattcgctcaccgacaacctggcggcgcgcgccagccgcctgcgcatcaacgccatc
cgcgcggtggagacgaagccggtgacgcgcttcctggagggcgcgccgctgcggggtcac
cgcacccgcgtggacctggacgaagagaacttcatgggcgtgggcgattcgttcctcttc
ggctccgtgctggaggaactgctcgcctcccacgtcaccatcaactccttcaacgagctg
agcatccggcttcacccctcgcagacggagttcgcgtggcttccgaggaacggctcccag
acgcttttgtag

DBGET integrated database retrieval system