KEGG   Myxococcus xanthus: MXAN_4812
Entry
MXAN_4812         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
mxa  Myxococcus xanthus
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mxa02044]
    MXAN_4812
Secretion system [BR:mxa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MXAN_4812
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABF91965
UniProt: Q1D300
Position
6020862..6021833
AA seq 323 aa
MGFFPLVAFLERLTSQATRVGGAGPVNEEMIRFRHDPSLGFPSGDVSSVTLHQVPVRAED
PYSKRPLFEVVTRFLGLTGAVSPLPHYLAEEVAQEDPDHPVRREFLDLFHHRLLSLLYRI
ESKYRVTSETDTSFSDQWSRRLLALGGFDTYEKALEGTLPTWRLLRIAPLLASRARTSEQ
LEVALEDVLGDDLEGARVSVRQFVGRWVDIDARARLGHSNHQLGRNMLLGGKAFDRTGKI
QIHIRPLPPRAYKRLMQEGDLLPLVREVVALFVRDPLEYDLELGLTEGVQHQFRLSSREP
SQLGRDTWLGLSQQTQMSVPVVK
NT seq 972 nt   +upstreamnt  +downstreamnt
gtgggcttctttcccctggtggcgttcttggagcggctgacgtcgcaggccacgcgcgtg
ggcggcgcggggcccgtcaacgaggagatgattcgcttccggcacgacccgtccctgggg
ttcccctcgggcgacgtgtcgtccgtgacgctccaccaggtgccggtgcgggcggaggac
ccgtattcgaagcggccgctcttcgaggtggtgacacgcttcctgggcctgacgggcgcg
gtgagtcccctgccccactacctggccgaggaggtcgcgcaggaggacccggaccacccg
gtgcggcgcgagttcctggacctgttccaccaccggctgctgtcgctgctgtaccgcatc
gagtcgaagtaccgcgtcacgagcgagacggacacatccttctcggaccagtggtcccgg
cgcctgctggcgctgggcgggttcgacacctacgagaaggccctggagggtacgctgccg
acctggcgcctgctgcggattgccccgctgctggccagccgggcgaggacgtccgagcag
ttggaggtcgcgctcgaggacgtgctgggcgacgacctggagggcgcgcgggtgtcggtg
cgccagttcgtgggccgctgggtggacatcgacgcccgggcgcggctgggccactccaac
caccaactggggcgcaacatgctgctgggcggcaaggccttcgaccggacggggaagatt
caaatccacatccggccgctgccgccgcgcgcctacaagcggctgatgcaggaaggggac
ttgctgccactggtgagagaagtggtagccctcttcgtgagggaccccctggagtacgat
ttggagctggggctcaccgaaggcgtgcagcaccagttccggctctccagccgggagccg
agtcagctcgggcgggacacgtggctgggcctgagtcagcagacgcagatgagtgtcccc
gtggtgaaatga

DBGET integrated database retrieval system