KEGG   Myxococcus xanthus: MXAN_5020Help
Entry
MXAN_5020         CDS       T00366                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00900  Terpenoid backbone biosynthesis
mxa01110  Biosynthesis of secondary metabolites
mxa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MXAN_5020
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MXAN_5020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ABF88566
UniProt: Q1D2E8
Position
complement(6274722..6276050)
Genome map
AA seq 442 aa AA seqDB search
MSDTVTSRLPGFHKLPMEERHAHLSRMFRLTPEDLQQLLGSEALQPVLANQMIENAVGTF
SLPLGLGLNLQVNGRDYLVPMAVEEPSVVAAVSFAAKIVREAGGFIGEADPSLMIGQVQV
SRYGDPTVATERILEHKEQILALANSFHPAMVARGGGAKDVEVRVLPAPEGPRGEPLLIV
HLIIDAQEAMGANLINTMAEGVAPLIEQVTGGKVYLRILSNLADRRLARAMCRIPIPLLA
DFEMPAEEIAEGIAQASRFAEADPYRAATHNKGVMNGIDSVAIATGQDWRAIEAGAHAFA
CRNGQYRPLSTWYLEEGHLVGRIELPMALGTVGGPIKIHPGVQMALKLMQTTSVRELAMV
FAAVGLAQNFAALRALGSVGIQKGHMAMHARCVAVTAGARGDWVEKIANLLVKAGHVKVE
KARELLASLPAEDAAAATGTTV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgtgacgtcccggcttcccgggttccacaagctgccgatggaggagcgc
cacgcgcacctctcccgcatgttccggctcacgcccgaggacctgcagcagctgctgggc
tcggaggcgctccagcctgtcctggcgaaccagatgattgagaacgcggtggggaccttc
tccctcccgctgggcctgggcctcaacctccaggtcaacggacgtgactacctggtgccc
atggcggtggaggagccgtccgtcgtggcggcggtgtccttcgcggcgaagattgtccgg
gaggcgggcggcttcatcggcgaggcggacccgtcgctgatgattggccaggtgcaggtg
tcgcgctacggcgacccgacggtggccaccgagcgcatcctggagcacaaggagcagatt
ctcgcgctggccaacagcttccacccggccatggtggcgcgtggcggcggggcgaaggac
gtcgaggttcgcgtgctgccggccccggaagggccgcgcggcgagccgctgctcatcgtc
cacctcatcattgacgcccaggaggcgatgggggccaacctcatcaacaccatggcggag
ggcgtggcgccgctcatcgagcaggtgacgggcggcaaggtgtacctgcgcatcctctcc
aacctggcggaccgccggctggcgcgcgccatgtgccgcatccccatcccgctgctggcg
gacttcgagatgccggccgaggagatcgccgagggcatcgcccaggccagccgcttcgcg
gaggcggacccgtaccgcgcggccacgcacaacaagggcgtgatgaacggcattgactcg
gtggccatcgccacggggcaggactggcgcgccattgaagcgggcgcgcacgcgttcgcc
tgccgcaacgggcagtaccggccgctgtccacctggtacctggaagagggccacctggtg
ggccgcatcgagctgcccatggcgctggggacggtgggcgggcccatcaagatccacccg
ggcgtgcagatggcgctcaagctgatgcagaccacgtcggtgcgagagctcgccatggtg
ttcgcggcggtgggcctggcgcagaacttcgcggcgctccgggcgctgggcagcgtgggc
atccagaagggccacatggcgatgcacgcgcgctgcgtggcggtgacggcgggcgcgcga
ggcgactgggtggagaagatcgccaacctgctggtgaaggcgggccacgtgaaggtggag
aaggcccgcgagctgctggccagcctccccgccgaggatgccgcggccgcgaccggcacc
acggtctga

DBGET integrated database retrieval system