KEGG   Myxococcus xanthus: MXAN_5360Help
Entry
MXAN_5360         CDS       T00366                                 

Definition
(GenBank) glycosyl hydrolase, family 13
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00500  Starch and sucrose metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
Module
mxa_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MXAN_5360
Enzymes [BR:mxa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MXAN_5360
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MXAN_5360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C DUF3459 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABF87230
UniProt: Q1D1G3
Position
complement(6672072..6673838)
Genome map
AA seq 588 aa AA seqDB search
MGATVYAGGTTFRVWAPMASRVFVSGDFNGWGTWIELGNEFNGNFSGDVAGAVKGQKYKF
ITRNQWGSDAWRADPRSAWQENSTGSSIIYDHGEYWWNAQQYSSPGFNEMIIYEMHVGTF
HDSPGFGPGNWNSAIARLDHVRDLGANMIKVMPAYEFAGDFSWGYNAAFPFAPESAYGHP
NDMKRFVDEAHMRGIGVIFDVVHNHYGPSDLPMWCFSGDCLGSGGEYFYNDWRKSTPWGD
TRPDYGRPEVRAYIRDSMMNLTHSFRGDGLRWDATKYMRTQNGSDTTAIPDAWRVFRSIN
REINATQPWKISIAEDFGGGDFITNDATSDTSGGAGFDSQWGGDFVHAIRAAVIASNDSG
RDMNSVRNAITQRYSGRHTARVIYSESHDEVANGKARVPEEIWPGNAGSWAAKKRSTLAA
GVVFTSPGIPMIFQGQEFLEDGYFQDTDPVDWGKNSTYSGIRTLYRDLIRLRRNWFNNTR
GLRGGNVNVHHVNNSGKVIAYHRWESGGPGDDVVIVANFSGTYFPSYNIGFPRGGMWYAR
FNSDWNGYSGDFGNTASIDTVAYSGAKDGLSHNASFAIGPYSLVIFSQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaccgtctatgcgggtggcaccacgttccgcgtctgggcgccgatggcgagc
cgggtgttcgtctcgggcgatttcaacggctggggcacctggattgagctgggcaacgag
ttcaacggcaacttctctggcgatgtggcgggcgcggtgaagggccagaagtacaagttc
atcacccgcaaccagtggggcagcgacgcgtggcgggcggacccccgctcggcgtggcag
gagaactccaccggctccagcatcatctacgaccacggcgagtactggtggaacgcgcag
cagtacagcagccctggcttcaacgagatgatcatctacgagatgcacgtcggcacgttc
cacgactcgcccggcttcggccccggcaactggaacagcgcgattgccaggctcgaccac
gtccgggacctgggcgcgaacatgatcaaggtcatgcccgcgtacgagttcgccggtgac
ttctcctggggctacaacgctgccttcccgttcgcgccggagagcgcctacgggcacccc
aatgacatgaagcgcttcgtggacgaggcgcacatgcgtggcatcggcgtcatcttcgac
gtggtgcacaaccactacggccccagcgacctgcccatgtggtgcttcagcggcgactgc
ctgggctcgggcggcgagtacttctacaacgactggcgcaagagcacgccgtggggcgac
acccgtccggactacggccgccccgaggtccgcgcgtacattcgcgactcgatgatgaac
ctcacccattccttccggggtgacggtctgcgctgggacgccaccaagtacatgcgcacg
cagaatggcagcgacaccaccgccatccccgacgcgtggcgcgtgttccgctccatcaac
cgcgaaatcaacgccacgcagccgtggaagatcagcatcgccgaggacttcggcggtggt
gactttatcaccaacgacgccacgtccgacacctcgggcggcgcgggcttcgactcgcag
tggggcggcgacttcgtgcacgccatccgcgcggcggtcatcgcgtcgaacgacagcggc
cgtgacatgaactcggtgcgcaacgccatcacccagcgctacagcgggcggcacaccgcg
cgcgtcatctactcggagagccacgacgaggtggccaacggcaaggcgcgcgtcccggag
gagatctggccgggcaacgcggggagctgggccgccaagaagcgctccacgctggcggcg
ggcgtcgtcttcacctcgcctggcatcccgatgatcttccagggccaggagttcctcgag
gacggctacttccaggacacggaccccgtggactgggggaagaacagcacttacagcggc
atccggacgctgtaccgcgacctcatccgtctgcgccgcaactggttcaacaacacgcgc
ggcctgcgcggcggcaacgtcaacgtccaccacgtcaacaacagcggcaaggtgattgcg
taccaccgttgggagagcggcgggcctggggatgacgtcgtcatcgtcgccaacttcagc
ggcacgtacttccccagctacaacatcggcttcccgcgcgggggcatgtggtacgcgcgc
ttcaacagcgactggaacgggtactcgggcgacttcggcaacacggcgtcgattgacacc
gtggcctacagtggcgcgaaggacggcctgtcgcacaacgcgtcgttcgccatcggtccc
tactcgctggtcatcttctcgcagtag

DBGET integrated database retrieval system