KEGG   Myxococcus xanthus: MXAN_5572
Entry
MXAN_5572         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB
Motif
Pfam: Amidohydro_2 LysM
Other DBs
NCBI-ProteinID: ABF87745
UniProt: Q1D0W2
Position
complement(6920542..6922551)
AA seq 669 aa
METYVVKDGDSPDSIAQKYGFKEWKLIYEHPDNGGLRATRGANEVKADDRVIIPDLPENQ
VSAGGPQNLIATPGTPLTLPPVHFDAHMHIMSGNCTPMPALVQMMKDKGLGFLIGTGTSR
TKINRLGFWAAKIPFAPDIGDVSHRDTHRIGEEAVRSNDSLAQDRTGYTSDGMGNVEEYT
IPAPLRAYASTQGHAEASASYMGMSIVLTMDMDYCHLAGYQGDPIYSSDFDGAEPRFTYR
WRTKSDDPGELIEAKSDEIRLHETWDRQLRHTEQVVAENPFRLLPMFHFEPRRFIKNEDK
SFPFEKVVTASKAAPYIGFKMYTPQGYMPKERHAPVKDILSWFFSECASNDIPLMTHCTP
SGFYTHERRFYLDHEPDEAIRNDPKYWPSKDAIATADANITKARDYVTELEASWKSHIPL
VLRRARNGVEDAIEAKEKLLNPGRMRYFYENYVHPEAWRPVLNDNPKLRLCLAHFASDGT
FWDIRKGLTVKQDGQKVQYDKSWIGSIVELCNEFPNFYTDISYLDLMEKQKWKLLADILK
SSPWMLKKIMFGTDWYMITAEPVAYAAWYSRTIRGLEFIQKELPTQVNLFTQFAIVNPMR
YYRMMEVAPKMKEGLKKLQTDLNVTGAAVDKLEDNFTTLMRLQHPLEQIDKAGGLASGPM
LFTATTKAK
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggaaacgtacgtcgtcaaggacggggactcccccgactcaatcgcgcagaagtacggg
ttcaaggaatggaagctcatctacgagcatccggacaacgggggcctgcgcgccactcgc
ggcgccaatgaagtgaaggcggatgaccgggtcatcatcccggacctgccagagaaccag
gtgtccgccggaggtccgcagaacctcatcgccacgccgggaacgccgctcaccttgccg
cccgtccacttcgacgcacacatgcacatcatgagcggtaactgcacgcccatgcccgcg
ctggtgcagatgatgaaggacaagggcctgggctttctcatcggcacgggcaccagccgc
accaaaatcaaccgcctgggcttctgggcggcgaaaatcccgttcgcgcccgacatcggt
gatgtgtcccaccgcgacacgcaccgcattggtgaagaggccgtgcgctccaatgacagc
cttgcccaggaccggacgggatacacctcggatggaatgggcaacgtggaggagtacacc
atccccgcgcccctgcgagcctatgcgtccacgcagggccacgcggaggccagcgcttcc
tacatgggcatgtccatcgtcctcaccatggacatggattactgccacctggctggctac
cagggggaccctatctacagctcggattttgatggggccgagccccgcttcacctatcgc
tggcgcacgaagtccgacgaccctggcgagctgattgaagcgaagtccgatgagatacgg
cttcacgagacgtgggaccggcagctccggcacaccgagcaggtggtcgcggagaatccc
ttccggttgctgcccatgtttcatttcgaaccgcgccgcttcatcaagaacgaggacaag
tcgttccccttcgaaaaggtggtgacggcctccaaggcggctccctacatcggcttcaag
atgtacacgccccagggctacatgcccaaggagcgccatgcgccggtgaaggacatcctg
agctggttcttctccgagtgcgcgtcgaacgacatcccgctgatgacccactgcacgccg
tccggcttctacacacacgagcggcgcttctacctggaccacgagccggacgaggccatc
cgaaacgacccgaagtactggccctcgaaggacgccatcgccaccgcggacgcgaacatc
accaaggcgcgcgactacgtgacggagctggaggcgagctggaagagccacatcccgctc
gtgctccgccgcgcgcgcaatggcgtggaggacgccatcgaggccaaggagaagctgctg
aacccgggccggatgcgttacttctatgagaactacgtgcacccggaagcgtggcgcccg
gtgctcaatgacaatccgaagctgcgcttgtgcctggcgcacttcgccagcgacggcacc
ttctgggacatccgcaaggggttgaccgtcaagcaggatggccagaaggtccagtacgac
aagagctggattggctccatcgtcgagctgtgcaacgagttccccaacttctacacggac
atctcctatctggacctgatggagaagcagaagtggaagctgctggctgacatcctcaag
tccagtccgtggatgctgaagaagatcatgttcggcaccgactggtacatgattaccgcc
gagcccgtggcgtacgcggcttggtacagccgcaccatccgcgggctggagttcatccag
aaggagctgccgacgcaggtgaacctcttcacccagttcgccatcgtcaatcccatgcgc
tactaccgcatgatggaggtcgccccgaagatgaaggagggcctcaagaagcttcaaacg
gacctcaacgtgacgggcgccgcggtggacaagctcgaggacaacttcacgacgctgatg
cggctgcagcacccgctggagcagattgacaaggcgggcggcctggccagcggtcccatg
ttgttcaccgcgaccacgaaggcgaagtag

DBGET integrated database retrieval system