KEGG   Myxococcus xanthus: MXAN_5841Help
Entry
MXAN_5841         CDS       T00366                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00071  Fatty acid degradation
mxa00280  Valine, leucine and isoleucine degradation
mxa00281  Geraniol degradation
mxa00310  Lysine degradation
mxa00360  Phenylalanine metabolism
mxa00362  Benzoate degradation
mxa00380  Tryptophan metabolism
mxa00410  beta-Alanine metabolism
mxa00627  Aminobenzoate degradation
mxa00640  Propanoate metabolism
mxa00650  Butanoate metabolism
mxa00903  Limonene and pinene degradation
mxa00930  Caprolactam degradation
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01212  Fatty acid metabolism
Module
mxa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MXAN_5841
   00650 Butanoate metabolism
    MXAN_5841
  Lipid metabolism
   00071 Fatty acid degradation
    MXAN_5841
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_5841
   00310 Lysine degradation
    MXAN_5841
   00360 Phenylalanine metabolism
    MXAN_5841
   00380 Tryptophan metabolism
    MXAN_5841
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MXAN_5841
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MXAN_5841
   00281 Geraniol degradation
    MXAN_5841
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXAN_5841
   00627 Aminobenzoate degradation
    MXAN_5841
   00930 Caprolactam degradation
    MXAN_5841
Enzymes [BR:mxa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MXAN_5841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABF90303
UniProt: Q1D045
Position
complement(7245606..7246433)
Genome map
AA seq 275 aa AA seqDB search
MDGTYKSLRIEKNEGVAELVLTGPGKGNAMGPDFWREMPEAIRALDADDSVRVVLVRGEG
KHFTFGLDLMGMMESLGPLLTGESNLALERLKLLSLIGDMQQATEGMARCRKPVIAAVHG
WCIGGGMDLIAACDFRYCSQDAKFSLREVKVGIVADLGALQRLPRIIGEGHTRELAYTGG
DVDAARALRMGLVNEVFPTPEALLEEARATAKRIAENAPLVVQGAKQVMEYCADKSIADG
LRYVAVWNSAFLQSHDLAEAFSAFVERRPPHFQGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggacgggacctacaagtcgctgcgcatcgagaagaatgaaggcgtcgccgagctggtg
ctcaccggccctggcaagggcaacgccatggggcccgacttctggcgggagatgcccgag
gccatccgcgcgctggatgcggatgactccgtccgcgtcgtgctggttcgcggcgaaggc
aagcacttcaccttcggcctggacctcatggggatgatggagtccctggggccgctgctc
accggcgaaagcaacctggccctggagcgcttgaagctgctgtcgctgattggcgacatg
cagcaggccaccgagggcatggcccgctgccgcaagcccgtcatcgccgccgtgcacggc
tggtgcatcggtggcggtatggatctcatcgccgcgtgtgacttccggtactgctcccag
gacgcgaagttctccctgcgcgaggtgaaggtgggcatcgtcgccgacctgggcgcgctc
cagcgcctgcctcgcatcatcggcgagggccacacgcgcgagctggcctataccggtggt
gacgtggacgcggcgcgcgccctgcgcatggggctggtgaacgaggtgttccccacgccg
gaggccctgctggaggaggcccgagcgaccgcgaagcgcatcgccgagaatgccccgctc
gtcgtccagggcgccaagcaggtcatggagtactgcgcggacaaatccatcgcggatggc
ctgcgttatgtggcggtatggaactccgcgttccttcagtcccatgacctggccgaagcc
ttttccgcattcgtggaacgccgcccccctcactttcaggggcgctga

DBGET integrated database retrieval system