KEGG   Mycobacterium xenopi: MYXE_10650
Entry
MYXE_10650        CDS       T06649                                 

Definition
(GenBank) putative short-chain type dehydrogenase/reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mxe  Mycobacterium xenopi
Pathway
mxe00903  Limonene and pinene degradation
mxe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mxe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYXE_10650
Enzymes [BR:mxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MYXE_10650
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BBU21276
Position
complement(1100840..1101679)
AA seq 279 aa
MTGRVEGKVAFITGAARGQGRSHAVRLAQEGADIIAIDVCKPIVENTTIPASTPEDLAET
ADLVKGLDRRIVTAEVDVRDYTALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEH
DWQEMIDVNLSGVWKTVKAGVPHILAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVG
LMRTFAVELGQHMIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPEDLKVVAQMMHTL
PIGWVEPEDISNAVLFLASEESRYITGVTLPVDAGSCLK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactgggcgagtcgaaggcaaggtcgcatttatcaccggcgcggcgcgtggccaaggt
cgatcgcatgcagtgcgattggcgcaggagggcgccgacatcatcgcgatcgacgtctgc
aagccaatcgtcgagaacaccacgattcccgcttcgacaccggaggatctggctgagact
gcggacctcgtcaagggcctcgaccgtcgcatcgttaccgctgaagtcgatgtccgtgac
tacaccgcactgaaagccgcagtggacagcggcgtggagcaacttggccgactggacatc
atcgtggccaacgccggcatcggcaacggcggcgacaccctcgacaaaaccagtgagcac
gattggcaggaaatgatcgacgtaaacctgtccggggtgtggaagaccgtgaaagccggt
gtgccacatattcttgcgggtggccgcggcggctcaatcatcttgaccagctcggtcggc
gggctgaaggcatacccgcacaccggtcattatgtggcagccaaacacggtgttgtcgga
ctgatgcgcacgtttgcggtcgagttgggtcagcacatgattcgcgtcaactcggtgcac
ccgaccaacgtgaacaccccgttgttcatgaacgagggcacgatgaagctgttccgtccc
gacctcgagaaccccggccccgaggacctgaaggtcgtcgcacagatgatgcacacgctg
ccgatcggctgggtggaacctgaggacatcagcaacgcggtgctgttcttggcgtccgaa
gagtcccgttacatcaccggtgtgacgctcccggtcgacgctggcagttgcctgaagtaa

DBGET integrated database retrieval system