KEGG   Moritella yayanosii: MORIYA_2115Help
Entry
MORIYA_2115       CDS       T05564                                 

Gene name
ltaE
Definition
(GenBank) L-allo-threonine aldolase, PLP-dependent
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mya  Moritella yayanosii
Pathway
mya00260  Glycine, serine and threonine metabolism
mya01100  Metabolic pathways
mya01110  Biosynthesis of secondary metabolites
mya01120  Microbial metabolism in diverse environments
mya01130  Biosynthesis of antibiotics
mya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MORIYA_2115 (ltaE)
Enzymes [BR:mya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MORIYA_2115 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: SQD78593
UniProt: A0A330LPG5
Position
MORIYA:complement(2153696..2154706)
Genome map
AA seq 336 aa AA seqDB search
MFDFRSDTVTQPTAAMREAMATAVVGDDVYGDDPTVNKLEQMAAERYGFDAAIFCSSGTQ
ANLLAIMAHCQRGDEYICGQNAHNYRWEGGGAAVLGSVQPQPIANEADGSICLQAIRDNI
KPDDDHHAKTKLLSLENTIGGKVLSLEYLAQAQALAFEHGLRIHLDGARVFNAAVKLNVD
ASEITQYFDSVSICLSKGLAAPVGSLLLGSESLIRSARRWRKMLGGGMRQAGILAAAGIL
ALDEQIDKLAIDHEKTQYLAHQLLTLTEFTFDLDSVQTNMIFTQYTGKDGKALSAYLRTK
GIIISASNAIRFVVHQDITVDAIDLLITEIKHFHSM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttagaagtgatacggtaacgcaacccaccgccgctatgcgtgaagctatg
gcgactgccgttgtaggtgatgatgtttatggcgatgatccaaccgtgaataaactcgaa
caaatggccgcagagcgttatggatttgatgctgctatcttttgttcgtcaggtacacag
gctaacttgttagctattatggcgcattgtcagcgaggtgatgaatatatttgtggtcaa
aatgcccataactatcgttgggaaggcgggggtgctgcggtattaggtagtgtacaacca
caacctattgccaacgaggccgatggtagtatttgtctacaagccattcgtgacaatatt
aaaccggatgatgatcaccatgctaaaaccaaattgttatcattagaaaataccattggc
ggtaaagtcttatcgcttgagtatctagctcaagcgcaagcattggcctttgagcatgga
ttacgtattcaccttgatggggcgcgtgtctttaatgccgcggttaaacttaacgtcgat
gcgagtgagatcacccaatattttgattccgtatctatttgcttatcgaaaggacttgca
gcaccggttggttcattattacttggctctgaatcattaattcgcagtgccagacgctgg
cgtaaaatgctgggtggcggtatgcgtcaagcgggtattctggccgcagccggtatttta
gcgttagatgagcaaattgataagttagcgattgatcatgaaaaaacgcaatatttagca
caccaattattgaccctgactgagtttacttttgatttagacagtgtgcaaaccaatatg
atctttactcaatacacagggaaagatggtaaagcactgtcggcatatttacgtactaaa
ggcattattattagtgccagtaatgcgatccgttttgtggttcatcaagatattaccgtt
gacgcaatcgacttattaattacagagattaagcattttcattcaatgtaa

DBGET integrated database retrieval system