KEGG   Moritella yayanosii: MORIYA_3397Help
Entry
MORIYA_3397       CDS       T05564                                 

Definition
(GenBank) putative phosphate permease HI_1604
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mya  Moritella yayanosii
Brite
KEGG Orthology (KO) [BR:mya00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MORIYA_3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: SQD79852
UniProt: A0A330LTZ4
Position
MORIYA:complement(3482857..3484131)
Genome map
AA seq 424 aa AA seqDB search
MEIIQAYGPHLLFLAAIFGLYMAWGIGANDVANAMGTSVGTKSLTVKQAIFIAIIFEFAG
AYLAGGEVTDTVRKGIIDLAVFKEQGRPDALAFGMIASLLAAGTWLMIASIFGWPVSTTH
SIIGAIIGFAVVSVGPEAVQWDKAGGIVGSWVLTPILSGVIAYITFMSIQKLIFDTKDPL
ANAKRYVPFYMALTTFVIAMVTIKKGLKHVGLHLTTGEALAASAVISLLIAIVGAIYISK
QNYSPSNDEDMHFSNVEKIFGILMIITACAMAFAHGSNDVANAIGPLAAVVSIVQHGGEI
SEKAEIAWWILPLGGFGIVVGLATMGHKVMSTIGTGITELTPSRGFAAQLATATTVVIAS
GSGLPISTTQTLVGAVLGVGMARGIAALNLNVVRTIVISWVVTLPAGAVLSIIFYKILEA
IFVV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcattcaagcatacggtcctcatctactgtttcttgcggctatcttcggtctt
tatatggcatggggcattggtgccaatgacgtagcaaatgcaatggggacctctgtaggc
accaaatcactgaccgtaaaacaagcgatctttattgccatcatctttgaatttgccggc
gcttatttagccggtggtgaagtaaccgataccgttcgtaaaggtattattgaccttgcc
gtatttaaagaacaaggccgccctgatgcattagcatttggtatgatcgcgtcgctactc
gcagcgggcacctggttgatgatcgcatcaatttttggctggccggtatcaacgacacac
tcaattattggtgccatcatcggttttgcggttgtcagtgtcggtccagaagccgtacag
tgggataaagccggtggtattgtgggcagttgggtgctcacaccaatactctcaggtgtc
atcgcttacatcacctttatgagtattcaaaaactcatttttgataccaaagatccgctg
gctaacgccaaacgttacgtacctttctacatggctctaacgacatttgttattgccatg
gtcaccattaaaaaaggccttaaacatgtcggtttacatttaactacaggtgaagcgtta
gccgcatcggcagtgatcagtctactgattgctattgtgggtgccatttatatcagcaaa
cagaactacagcccaagtaatgacgaagacatgcacttctctaatgtagagaaaatattt
ggtatcttaatgatcattaccgcgtgtgcaatggcctttgcgcacggctctaacgatgta
gccaatgcgattggtccattagccgcggtggtctctattgttcaacacggtggtgaaatt
tccgaaaaagccgagatagcgtggtggatcttaccacttggtggtttcggtatcgtggtt
ggtctagcgactatgggtcataaagtgatgtcaactatcggtaccggtatcaccgaacta
accccaagccgtggctttgctgcgcagctagcaacagcgacaacggttgttattgcctca
ggctcaggtttacctatctcgaccacacaaacgctcgttggggctgtgttaggtgtaggt
atggcgcgtggtattgcggcactcaatctaaacgtcgtcagaacgatcgtgatctcttgg
gtcgtgacactacctgctggagcagtgctgtcaattatcttctacaagatcttagaagct
atctttgtagtgtaa

DBGET integrated database retrieval system