KEGG   Moritella yayanosii: MORIYA_3491Help
Entry
MORIYA_3491       CDS       T05564                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
mya  Moritella yayanosii
Pathway
mya00740  Riboflavin metabolism
mya00790  Folate biosynthesis
mya01100  Metabolic pathways
mya01110  Biosynthesis of secondary metabolites
mya02024  Quorum sensing
Module
mya_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MORIYA_3491 (ribA)
   00790 Folate biosynthesis
    MORIYA_3491 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MORIYA_3491 (ribA)
Enzymes [BR:mya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     MORIYA_3491 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: SQD79946
UniProt: A0A330LUH5
Position
MORIYA:complement(3570894..3571502)
Genome map
AA seq 202 aa AA seqDB search
MSIKFIASSKLPTPFGTFTMHGFEDSETGKEHVALTYGELAKDEVILGRIHSECLTGDAL
FSLRCDCGFQLETAMKNISDAGAGFILYLRQEGRGIGLLNKIRAYNLQDAGANTVEANEK
LGFAADLRNYAMCKPMLDHLGISKVRLMTNNPKKLAAMDECGVNVVARQPLQVGKNMHNE
HYLRTKADKLGHMMTEEHFKED
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattaaatttatcgcatcttcaaaactacccacaccttttggtactttcactatg
cacggcttcgaagactcagaaacaggcaaagaacatgtggcactaacgtatggtgagtta
gctaaagacgaagtcatattaggtcgtattcattcagaatgtttaaccggtgatgccttg
tttagtttacgttgtgattgtggctttcaacttgaaaccgcaatgaaaaatatctccgac
gcaggtgctggctttattctgtatttacgtcaagaaggtcgtggtattggtctgttaaac
aagatccgtgcgtataatttacaagacgctggtgccaacacggttgaagcgaacgaaaaa
ttaggttttgctgcagacctacgtaattatgccatgtgcaaacctatgttagaccacctc
ggtattagcaaagtgagactcatgaccaataacccgaaaaaattagcggcgatggatgaa
tgcggcgttaatgtggtggctcgtcagccattgcaagtgggtaagaatatgcacaatgaa
cattatttgagaaccaaagccgacaagcttgggcatatgatgacagaagaacatttcaaa
gaagattaa

DBGET integrated database retrieval system