KEGG   Moritella yayanosii: MORIYA_3495Help
Entry
MORIYA_3495       CDS       T05564                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mya  Moritella yayanosii
Pathway
mya00860  Porphyrin and chlorophyll metabolism
mya01100  Metabolic pathways
mya01110  Biosynthesis of secondary metabolites
mya01120  Microbial metabolism in diverse environments
Module
mya_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MORIYA_3495
Enzymes [BR:mya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MORIYA_3495
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MORIYA_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH TP_methylase
Motif
Other DBs
NCBI-ProteinID: SQD79950
UniProt: A0A330LSX0
Position
MORIYA:3572632..3573576
Genome map
AA seq 314 aa AA seqDB search
MQYLPIFMDVNDKNVLVVGGGEVASRKVDLLLSASAKVTVLSPRLNDTLQRYRDDAKITV
IIDGYHRDYLGHYVMVWVTTDNTLLNKQVWQDCCERNLLVNVADQPELCEFITPSIIDRS
PLQIAISSGGLSPVLIRYVREKLEALLPETLGPLGAFAGEQRERVKQQFSSVTERRRFWE
RFFSSKAVMLATDKGQLQQEFDLQLTTPESDVDGDIYLIKLPDETDLLRLRSLRLMQQAD
VILYVEDGDDCNERIADFVELCRRDAERYPLLSADFSTQAQARKQQGERVCVLINSTAQF
ETLTNTLDAISVVA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatttgccaatttttatggatgtaaatgataaaaacgtactggtagtcggtggc
ggtgaagtggcaagtcgaaaagttgacttgctattgagtgcgagtgctaaggtgacggtt
ttatctccgcgtttaaatgatacgctgcaacgttatcgagatgatgccaaaattacggtt
atcatcgacggttatcatcgcgattaccttggtcattacgtgatggtatgggtgaccact
gacaataccttgcttaataaacaagtatggcaagactgctgcgaacgtaacttattagtc
aatgttgcagatcaacctgaactgtgtgaatttatcaccccttctattatcgatcgttca
ccattacaaatcgcgatctccagtggtggattgtcgccagtactgatccgttatgtacgt
gaaaaactcgaagctttgttacccgaaacgctgggaccactcggtgcctttgcgggtgag
caacgtgagcgggtaaaacaacaatttagtagtgtgacagagcggcgtcgattttgggaa
cgttttttcagttctaaagcggtgatgttggcaaccgacaaagggcaattacaacaagaa
tttgacctgcaattaacgacaccagaaagcgatgttgacggtgatatttatttaattaaa
ttacctgacgaaacagatctattacgactaaggtccttacgcttaatgcaacaagctgat
gtgatcttatacgtcgaagacggtgatgactgtaatgaacgtatcgctgactttgttgaa
ttatgtcgccgagatgccgagcgttatccactattaagtgctgatttttccacgcaagca
caagcgcgtaagcagcaaggtgagcgtgtatgtgtattgattaatagcactgcacagttt
gagacactcactaatacgcttgacgcgataagtgtcgtcgcttaa

DBGET integrated database retrieval system