KEGG   Myotis brandtii (Brandt's bat): 102239051Help
Entry
102239051         CDS       T02920                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like
Organism
myb  Myotis brandtii (Brandt's bat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 102239051
NCBI-ProteinID: XP_005880950
Position
Un
AA seq 126 aa AA seqDB search
MGKGSQPGTRSLTSQGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERS
PFGNQENVRWRKSVTHWKQTSDRVDKTKDEMEQEALVEGNLATEVSLVVLDTLEIIVQVR
LDPASS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagggcagtcagcctggaacccgttctttgacctcccaggggaaaaaggccttt
gagcgcatcaacagcctcacattcaagaagtcactggacatgaaggctcgactggaggaa
gccatcttgggcaccattggtgcacgacaagagatggtgcgacggagccgtgagaggagc
ccgttcgggaaccaggagaacgtacgctggcggaagagcgtcacacactggaagcagacc
tcggaccgtgtggacaagaccaaggatgaaatggaacaggaggccttggtggaagggaac
ctggccaccgaggtgagcctggtagttctggacacgctggagatcatcgtgcaggtgagg
ctggacccagcatcttcctga

DBGET integrated database retrieval system