KEGG   Myotis brandtii (Brandt's bat): 102239093Help
Entry
102239093         CDS       T02920                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:myb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102239093
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:myb03012]
    102239093
Translation factors [BR:myb03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102239093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 102239093
NCBI-ProteinID: XP_005870382
UniProt: S7PHQ2
Position
Un
AA seq 911 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPEQSADEDAEKNEEDSEG
SSDGDEDGVSAAAFLKKKSEAPSGESRKFLKKMEDEDEDSEDSEEDEEWDTGSTSSDSDS
EEEEGKQTVLASRFLKKAPATEEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWE
RVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRASQIELLQLLVQIAS
ENNLGEGVAIKIKFNIIASLYDYNPNLATYMKPEMWQKCLDCINELMDILFANPNIFVGE
NILEESENLHNVDQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAI
IERVQHYLEEKGTTEEICRVYLRRILHTYYKFDYKAHQRQLTLPEGSSKSDQDQAENEGE
DSALLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHAD
PPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQ
EKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGE
RQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRK
IQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTV
VMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRG
GYRQQQSQTAY
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggttttttaccaccggttcggacagcgagtccgagtcgtccctgtccggggag
gagctcgtcaccaaacctgtcgggggcaactacggcaaacagccactgttgctgagtgaa
gatgaagaagataccaagagagtggttcgaagcgccaaggacaagaggtttgaggagttg
accaaccttatccggaccatccgtaatgccatgaaaattcgggatgtcaccaagtgcctg
gaagaatttgagctcctgggaaaggcgtatgggaaggctaaaagcattgtggacaaggaa
ggtgtcccccggttctatatccgcatcctggctgatctggaggactatcttaatgagcta
tgggaagataaggaaggaaagaagaagatgaacaagaacaacgccaaggccttgagcact
ctgcgccagaagatccgaaaatataaccgagattttgagtcccatattacaaattataaa
cagaaccctgagcagtctgcagatgaagatgctgagaagaatgaggaggattcagaaggc
tcttcagatggggatgaggacggagtcagtgctgcggctttcttgaagaagaaatcagaa
gctccttctggggagagtcgcaagttcctcaaaaagatggaggatgaagatgaggactca
gaagattcagaagaggatgaagagtgggacacaggttcaacatcttctgactcagactca
gaggaggaagaagggaaacagaccgtgctggcctcaagattccttaaaaaagccccggcc
acagaggaggacaagaaggctgctgagaagaaacgggaagacaaagccaagaagaagcac
gataggaaatctaagcgcttggatgaggaggaggaggacaatgaaggcggggagtgggaa
agggtccgaggtggagtgcccctcgttaaggagaaaccaaaaatgtttgccaagggaact
gagatcacccatgctgttgtcatcaagaaactgaatgagattctgcaggcacgaggcaag
aaaggaactgatcgtgcatcccagattgagctgctacagctgctggttcagattgcttct
gaaaacaatcttggggagggtgtcgccattaagatcaagttcaatatcatcgcctctctc
tatgactacaaccccaacctggctacatacatgaagcctgagatgtggcagaagtgcctg
gattgcatcaatgagctgatggacatcctgtttgcaaaccccaacatctttgttggagag
aacattctggaagagagtgagaacctgcataatgttgaccagccactgcgtgtccgtggc
tgtatcctaactctggtggaacggatggatgaagaatttaccaaaataatgcaaaatact
gaccctcactcccaagagtatgtggagcacctgaaggatgaggcgcaggtgtgtgccatc
attgagcgtgtgcaacactacctggaagagaaggggaccactgaggagatctgtcgtgtc
tacttgaggcgcattctccacacctactacaagtttgattacaaggcccatcaacggcag
cttaccctccctgagggctcctcaaagtctgaccaagatcaggcagaaaatgagggcgag
gactcagctctgctgatggagagactttgcaagtacatctatgccaaagaccgcacagac
cgaattcgcacgtgcgccatcctctgccatatctaccatcatgccctgcactcccgctgg
taccaggcccgtgacctcatgcttatgagccacctacaagacaacattcagcacgcggat
cctccagtacagatcctgtacaaccgcaccatggtgcagctgggcatctgtgccttccgc
caaggcctgaccaaggatgctcacaatgccctgctggacatccagtcaagtggccgggcc
aaggagctcctgggtcagggtctgctgctgcgcagcctccaggagcgcaaccaggagcag
gaaaaggtggagcggcgccggcaggtgcccttccacctgcacatcaacctggagctgctg
gagtgtgtttacctggtgtctgccatgctcctggagatcccctacatggccgcccatgaa
agtgatgcccgccggcgcatgatcagcaagcagttccatcaccagctgcgggtgggcgag
cgacagcccctgttgggcccccctgaatcaatgagggaacatgtggtcgctgcctccaag
gctatgaagatgggtgactggaagacctgccacagctttataatcaacgagaagatgaat
ggcaaagtgtgggaccttttccctgaggctgacaaagtccgaaccatgctggttaggaag
atccaggaagagtcactacggacctacctcttcacctacagcagtgtctatgactccatc
agcatggagacactgtctgacatgtttgagctggacctacccactgtacactccatcatt
agcaagatgatcattaatgaggagttgatggcctccttggaccagccaacacagacagtg
gtgatgcaccgcacggagcccactgcccaacagaacctggctctgcagctggcggaaaag
ctgggcagcctggtggaaaataatgagcgggtgtttgaccacaagcagggtacctatggc
ggctacttccgagaccagaaggatggctaccgcaaaaacgaaggctacatgcgccggggt
ggctaccgccagcagcagtctcagacagcctactga

DBGET integrated database retrieval system