KEGG   Myotis brandtii (Brandt's bat): 102239337
Entry
102239337         CDS       T02920                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:myb03021]
    102239337 (AFF3)
Transcription machinery [BR:myb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102239337 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102239337
NCBI-ProteinID: XP_014385261
Position
Un
AA seq 1208 aa
MSLCPLLGPRGQKADQLTHAKIQGLVRFKSFPFCGVCVSYRGEDILNQRSDSLVVEFQSS
TSRCRSVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNT
LGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAAVNKIEEHFVADSRAQPQASSVCSTASST
PAAVPGQQSKRGTVGWQKAGHLPPDGPQRATQQSSLRTLLGDGAGRQQPRAKQVCNVEVG
LQTQERPPAMAAKHSGSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLK
SSTETSVHCTSYRGVPAAKPESTRAKAKLSKFSIPKPSEESRSGETNSCVEEIIREMTWL
PPLSAIQPPGKVEPSKFSFPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKL
SSDEEEGEQAAQGTTLHALSDSAGVQQASCRASVPSSKGSSSGSSSSGSSSSSDSESSSG
SDSESESSSSESEGSKPAHYSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGLES
SQYYAPGKDPAQDCGKLADGCQAGLREKDVKSACKEEQRPRTANKAPGTKGVKQKSPPAA
VAVPPEPTKARPCANSRTGHRKELRASVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSS
DSDLESEQEEYPLAKAPVVAAASASDQRLKEAAGSISSGGGPRAPVGSINARTTSDIAKE
LEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEAAALSAPAAKDA
ESAPPSHPSDTPVEKALPKSKRKRKCDNEDDYREVKKAQGEKESSSRQAASASNTVSANP
CNMNVSSLAIPINKNEKLLRSPISPLSDASKHKYSSEDLTSSSRSSGSGLFPSTASNKKL
KAESQLPAHAADLTKAAHHSSESVLHKPRPQTEPWSPGSSGHRDCKRQKLVFDDMPRSAD
YFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVEL
IRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSS
KAAQAPSPWGAGGKSTGTPSPMSPNPSPTSSVGSQGSLSNTSALSPSTIVSIPQRIHQMA
ANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHW
LRNSAHLP
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgtccttgtgccctctacttggccctcgggggcaaaaagcagaccagctcacacacgct
aagatacaagggctggtcaggtttaaaagttttcccttctgtggtgtctgcgtttcttac
aggggtgaagacatcttaaaccagaggagtgactctctagtcgtggaatttcagtcgtca
accagccgatgcaggagtgtctatgaaccagatagaaatgtgttacggaggaaagaacga
gaaaggagaaatcaggagactcaacaggatgatggcacatttaattccagttattccctc
ttcagtgaaccctacaagactaacaagggggatgagctctccaaccggatccagaatacg
ttaggcaattacgatgaaatgaaggactttttaactgatagatctaatcagagtcatctc
gttggcgttcccaaacctggggttcctcaggctgctgtgaacaagatcgaggaacatttt
gttgcagattcaagagcccagccccaggcctcctctgtgtgcagcactgcatcttccaca
ccagcggctgtccccgggcagcagagtaagaggggcaccgtgggctggcagaaggctggg
cacctgcctcccgacggcccacagagagcaacacaacagagctctctcaggaccttgctt
ggagatggcgctggcaggcagcagccacgggccaaacaggtgtgcaatgtagaggtgggt
cttcagacccaggaaagaccacccgctatggcagccaagcacagcggcagtggacactgt
gttcagaactttcctccatccctggcttccaaacccagcctggtccagcagaaaccgacc
gcttacgtgcggccgatggatggccaagatcaggctcccgatgagtctccgaagcttaag
tcgtccacggaaaccagcgtgcactgcacgtcatacaggggcgtcccggccgccaagcca
gagtccaccagagccaaggccaagctttccaagttcagcatccccaagccatcggaggag
agtcgatctggagaaaccaacagctgtgtggaagaaataatccgggagatgacctggctt
ccaccactttctgctattcagccgcctggcaaggtggaacccagcaaattttcattccca
aataaggactctcagctggtttcctctggacacaataatccaaagaaaggtgatgctgag
cccgagagtccagacaatggcacctcgaatacatcaatgctagaagatgacctcaagcta
agcagtgatgaagaggagggtgaacaggcagcccagggaaccacgctccacgctctgtct
gacagcgccggggtccagcaggccagctgcagagcctcggtgccctccagcaagggcagc
agcagcggcagcagcagcagcggcagcagttcgtccagcgactcggagagcagctcggga
tccgactccgagagcgagagcagctccagcgagagcgagggcagcaagcccgcccactac
tccagccccgaggctgagcccgcgtcctctaacaagtggcagctggataaatggctaaac
aaagttaacccccacaagccgcctattctgatccagaatgaaagccacggcctggagagc
agtcagtactatgcccccgggaaggaccccgcgcaggactgcgggaaactcgccgacggg
tgccaggccggcctgagggagaaggacgtcaagagcgcctgcaaggaagagcagaggcca
aggacagccaacaaggccccggggacgaagggggtgaagcagaagtccccgcctgcggct
gtggccgtgcctccggagcccaccaaagccaggccctgtgccaacagcaggacgggccac
cgcaaggagctgcgcgcctcggtcacctgcgagaagcgccgcacgcggggcctgagcagg
atcgtccccaagtccaaggagttcatcgagacagagtcctcatcttcgtcctcctcctcg
gactctgacctggagtcggagcaggaggagtaccctctggccaaagcgccggtcgtggcc
gccgcctctgcgagtgaccagaggctcaaggaggccgccggcagcatcagcagcggcggc
gggccccgcgcacccgtgggctccatcaacgccaggaccaccagcgacatcgccaaggag
ctggaggagcagttctacacgctggttcccttcggccgcaacgaacttctctccccgctg
aaggacagtgacgaggtcaggtctctctgggtcaaaattgacctgaccctcctgtccagg
atcccagaacacttgccccaggaggccgcagccctcagcgcgcctgcagccaaggacgct
gagagcgcacctccaagccacccatccgacacacccgtagaaaaggctttgcccaaatcc
aagaggaaacgcaagtgtgacaacgaagacgactaccgggaggtcaagaaggcccaggga
gagaaagagagctcttcccggcaggccgcctctgccagtaacactgtgtctgcgaatcct
tgcaacatgaacgtcagcagcttggcaatacccatcaataaaaatgaaaagctgctccgg
tcgcccatctcacccctctccgacgcctctaaacacaaatactccagcgaggacttgacg
tcttccagcaggtccagcggcagtggcttgttcccttccaccgcctccaacaaaaagctc
aaggcggagagccagctgccggctcatgccgcagacctcacgaaagcagctcaccacagc
tcggaaagtgttctccacaagccacggccacagacggaaccgtggtccccgggctccagc
ggccaccgggactgcaagaggcagaaactcgttttcgacgacatgccgcgcagtgcagat
tattttatgcaagaagctaagcggatgaagcataaggcagatgcaatggtggaaaagttt
ggaaaggctttgaactacgccgaagcagccttgtcattcattgagtgtggaaatgcaatg
gaacagggcccaatggaatccaaatctccatacacaatgtattcagaaacagtggaactc
atcaggtatgctatgagactaaagacccactcaggccccaatgccacaccagaggataaa
cagctggctgcgttatgttaccgatgcctggctctcctgtactggcggatgtttcgactc
aaaagagatcacgctgtcaagtattcaaaagcacttatcgactatttcaagaattcatct
aaagctgcccaagccccatctccatggggagccggtggaaagagcactggaaccccatcc
cccatgtcccccaacccctcccccaccagctccgtgggatctcaggggagcctctccaat
accagcgccctgtccccttcgaccatcgtcagcatcccacagcgcatccaccagatggca
gccaatcacgtcagcatcaccaacagcattctccacagctacgactactgggagatggca
gacaacctggccaaggaaaaccgagagttcttcaacgacctggatctgctcatggggccg
gtcaccctgcacagcagcatggagcacctggtccagtactcccagcagggcctgcactgg
ctgcggaacagcgcccacctgccgtag

DBGET integrated database retrieval system