KEGG   Myotis brandtii (Brandt's bat): 102239836Help
Entry
102239836         CDS       T02920                                 

Gene name
HNF4A
Definition
(RefSeq) hepatocyte nuclear factor 4 alpha
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04152  AMPK signaling pathway
myb04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102239836 (HNF4A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    102239836 (HNF4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102239836 (HNF4A)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:myb03310]
    102239836 (HNF4A)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102239836 (HNF4A)
Nuclear receptors [BR:myb03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   102239836 (HNF4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 102239836
NCBI-ProteinID: XP_005871300
Position
Un
AA seq 474 aa AA seqDB search
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNATNNLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIIPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGPCPAPEGQRGSSSDATHAHHPLHPHLMQEHMGTNVIVANTMPT
HLSNGQMSTPETPQPSPPGGSGSEPYKLLPGAITTIVKPPSAIPQLTITKQEVI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctccaaaaccctggtcgacatggacatggccgactacagtgctgcgctggac
ccagcctacaccaccctggaatttgagaatgtgcaggtgttgacgatgggcaatgacaca
tccccatcagaaggtgctaacctcaatgcgaccaacaacctcggtgtcagtgccctgtgc
gccatctgtggagaccgggccacaggcaaacactacggcgcctcaagctgtgatggctgc
aagggcttcttccggaggagcgtgagaaagaaccacatgtactcctgcagatttagtcgg
cagtgcgtggtggacaaagacaagaggaaccagtgccgctactgcaggctcaagaagtgc
ttccgggctggcatgaagaaggaagccgtccaaaatgagcgggaccggatcagcactcgc
aggtcaagctatgaggacagcagtctaccctccatcaatgcgctcctgcaggcggaggtc
ctgtcccagcagatcacctcccctgtctctgggatcaacggagacatccgggcaaagaag
atcgccagcattgccgacgtgtgcgagtccatgaaggagcagctgctggtgctcgttgag
tgggccaagtacatcccagctttctgtgaactccccctggacgaccaggtggccctgctc
agagcccatgccggcgagcacctgcttctcggagccaccaagcgctctatggtgttcaag
gacgttctattattaggtaatgactacatcatcccccggcattgcccggagctggcagag
atgagccgggtgtccatgcgcatcctggatgagctggtgctgccgttccaggagctgcag
atcgatgacaatgagtatgcctgcctcaaagccatcatcttctttgacccagatgctaaa
ggtttgagtgacccgggtaagatcaagaggctgcggtcccaggtgcaggtgagcctggag
gactacatcaacgaccgccagtatgactcacgtggccgcttcggcgagctgctgctgctg
ttgcccaccctgcagagcatcacctggcagatgattgagcagatccagttcatcaagctc
tttggcatggccaagatcgacaacctgctgcaggagatgctgctgggaggtccgtgcccc
gccccggaggggcagagaggatcctccagtgatgcaacccatgcccatcatcccctgcac
cctcacctgatgcaggaacacatgggcaccaacgtcattgttgccaacacgatgcctact
cacctcagcaatggacagatgtccacccctgagactccacagccctcaccaccaggtggc
tcagggtctgagccctacaaactcctgccaggagccatcaccacaattgtcaagcccccc
tctgccatcccccagctgactatcacgaagcaagaagtcatctag

DBGET integrated database retrieval system