KEGG   Myotis brandtii (Brandt's bat): 102242434Help
Entry
102242434         CDS       T02920                                 

Gene name
PFKFB2
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  KO
K19029  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 2 [EC:2.7.1.105 3.1.3.46]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00051  Fructose and mannose metabolism
myb01100  Metabolic pathways
myb04152  AMPK signaling pathway
myb04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102242434 (PFKFB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102242434 (PFKFB2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102242434 (PFKFB2)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     102242434 (PFKFB2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     102242434 (PFKFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 His_Phos_2 AAA_17 APS_kinase
Motif
Other DBs
NCBI-GeneID: 102242434
NCBI-ProteinID: XP_005885275
Position
Un
AA seq 472 aa AA seqDB search
MSEDTASSSEQNNSSNQTTASNLRLSKKICSWASYMTNSPTLIVMIGLPARGKTYVSKKL
TRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCAVVALEDVKAYLT
EESGQIAVFDATNTTRERRDMILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDY
PERNRENVMEDFLKRIECYKVTYQPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKI
VYYLMNIHVYPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALKKFLEEQEIADLK
VWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIEKQYPEEFALRDQEKYLY
RYPSGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLH
TIFKLTPVAYGCKVETIKVNVEAVNTHRDKPAAKTSLAVPRRSSPASLPALS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggatactgcatcttcctcagaacagaacaatagcagcaatcaaaccacagcc
tccaatcttcgactgtccaagaagatatgttcgtgggcatcctacatgaccaactccccg
acgctcattgttatgattggcttgccagcccggggcaagacctatgtgtccaagaaactc
acacgttacctcaactggattggagtgcccaccaaagtgtttaatcttggggtatatcgg
cgtgaagcagtcaagtcctataagtcctatgacttcttccggcacgacaacgaggaggcc
atgaagattcgcaaacagtgtgctgtggtggcactagaagacgttaaggcgtatctcacc
gaggagagcgggcagattgcggtgtttgatgccaccaatacaactagggagaggagggac
atgattttgaactttgccgaggagaactccttcaaggtgttctttgtggaatctgtgtgt
gatgatcctgatgtcattgctgccaacatcctggaagtaaaggtatccagccctgattac
cctgaaaggaacagggagaatgtgatggaggacttcctaaagagaattgagtgctacaaa
gtcacctatcagccccttgacccagacaactatgacaaggatctttctttcatcaaggtg
atcaacgtgggccagcggtttctagtgaacagagtccaggactacatccagagcaagata
gtctactacctcatgaatatccacgtctatccccgcaccatttacctttgtcggcacggg
gagagcgagttcaacctcctggggaagattgggggcgactctggcctctcggtgcggggc
aaacagtttgcccaagctctcaagaagtttctggaggaacaggagatagcagatctcaag
gtgtggacgagccagttgaagaggactatccagactgcggagtcgctgggggtgacctat
gagcagtggaagattctgaatgagattgatgctggcgtgtgcgaggagatgacctacgca
gagattgagaagcagtacccagaggagttcgcacttcgggatcaagagaaatatctgtat
cgctatcctagcggggagtcgtaccaggacctggtgcagcggctggagcctgtcatcatg
gagctggagcgccagggcaatgtcctcgtcatctcccaccaggctgtcatgcgctgcctc
ctggcctacttcttggataagggtgcagatgagctaccgtacttgaggtgccctctccat
accatcttcaaacttactcctgtggcctacgggtgcaaagtggaaacgatcaaggtcaac
gtggaggctgtgaacactcaccgagacaagccagcggcaaagacctcgctggcggtgcct
agacgctcctctccggcctccctcccagcgctctcctga

KEGG   Myotis brandtii (Brandt's bat): 102243896Help
Entry
102243896         CDS       T02920                                 

Gene name
PFKFB1
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
  KO
K19028  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 1 [EC:2.7.1.105 3.1.3.46]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00051  Fructose and mannose metabolism
myb01100  Metabolic pathways
myb04152  AMPK signaling pathway
myb04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102243896 (PFKFB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102243896 (PFKFB1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102243896 (PFKFB1)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     102243896 (PFKFB1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     102243896 (PFKFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Zeta_toxin KTI12 Pox_A3L
Motif
Other DBs
NCBI-GeneID: 102243896
NCBI-ProteinID: XP_005860955
Position
Un
AA seq 448 aa AA seqDB search
MEEKTSKRTATIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRR
EAVSYKNYEFFLPDNMEALLIRKRCALAALKDVHDYLSREEGHVAVFDATNTTRERRSLI
LQFAKEHGYKVFFIESICNDPGIIAENIKQVKLGSPDYIDCDREKVLEDFLKRIECYELN
YQPLDDELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGESE
LNLRGRIGGDSGLSARGKQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQW
KALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELE
RQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEA
VNTHREKPENVDITRDPEEALDTVPAHY
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaacctctaagagaacagcaaccataccccagtttaccaattcccccaca
atggtgattatggtgggtttaccagctcgaggaaagacttacatctctacgaagctcacc
cgatatctgaactggataggaacaccaactaaagtgtttaatttaggccagtatcgacga
gaggcagttagctacaagaactacgaattctttcttccagacaacatggaggccctactt
atcaggaagcggtgtgctctggcagccctgaaggatgttcatgattatctcagccgtgag
gagggccatgttgcggtttttgatgccaccaacactaccagagaacgacggtcactgatt
ttgcagtttgccaaggaacatggttacaaggtgtttttcattgagtccatctgtaatgac
cctggtatcattgcagaaaacatcaagcaagtgaaactcggcagccctgattacatagac
tgtgaccgagaaaaggttctggaagactttctaaaaagaattgaatgctatgagctcaat
taccaacccctggatgatgaactggacagccacctgtcctacatcaagatcttcgacgtg
ggcacacgctacatggtgaaccgagtgcaggaccacatccagagccgcacagtatactat
cttatgaacatccacgtcacaccccgctccatctacctatgccggcatggtgagagtgaa
ctcaacctcagaggccgcattggaggtgactctggcctctcagctcggggcaagcagtat
gcttatgccctggccaacttcattcagtcccagggcatcagctccctgaaagtgtggacc
agccacatgaagaggactatccagacagctgaggccctgggcgtcccctatgagcagtgg
aaggccctgaatgagattgatgcgggtgtctgtgaggagatgacctatgaagaaatccag
gaacattaccctgaggaatttgcactacgggaccaagataaatatcgctaccgctatccc
aagggagagtcctacgaggatctggttcagcggctggagccggttataatggagctagaa
cggcaggaaaatgtactggtgatctgccatcaggctgtcatgcggtgcctcctggcctac
ttcctggataagagctcagatgagctgccgtatctcaagtgccctctgcacacagtgctc
aaactcacacctgtggcttatggatgcaaagtggagtccatctacctgaatgtggaggcc
gtaaacacacaccgagagaagcctgagaatgtggacatcacccgagatcctgaagaagcc
ctggacacggtccctgcccactactga

KEGG   Myotis brandtii (Brandt's bat): 102246760Help
Entry
102246760         CDS       T02920                                 

Gene name
PFKFB3
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
  KO
K01103  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 3 [EC:2.7.1.105 3.1.3.46]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00051  Fructose and mannose metabolism
myb01100  Metabolic pathways
myb04066  HIF-1 signaling pathway
myb04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102246760 (PFKFB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102246760 (PFKFB3)
   04152 AMPK signaling pathway
    102246760 (PFKFB3)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     102246760 (PFKFB3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     102246760 (PFKFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 AAA_18 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 102246760
NCBI-ProteinID: XP_014397770
Position
Un
AA seq 545 aa AA seqDB search
MPLELTQSRVQKIWIPVDHRPSLPRTCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKHYSSYNFFRPDNEEAMRVRKQCALAALRDVKSYLTKEGGQ
ISVFDATNTTRERRHMILNFAKENDFKVFFIESVCDDPTVVASNIREVKISSPDYKDCNS
AEAMEDFMKRINCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGESEHNLQGKIGGDSGLSVRGRKFANALSKFVEEQNLKDLKVWASQ
LKSTIQTAEALQLPYEQWKALNEIDAGVCEEMTYEEIKDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLRCPLHTVLKL
TPVAYGCRVESIYLNVESVNTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPNCLPPEVPAQLPGQPLLGKACLPVAFLLMNSRSIKRLGSGGTPGILRAV
VGGCP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcccctggagctgactcagagccgggtgcagaagatctggatcccggtggaccaccgt
ccttcgttgcccagaacctgtgggccgaagctgaccaactccccaacagtgattgtcatg
gtaggcctccctgcccggggtaagacctacatatccaagaagctgactcgatacctcaac
tggattggtgtccccacgaaagtgttcaacgttggagagtaccgccgggaggccgtgaag
cactacagctcctacaacttcttccgccctgacaacgaggaggccatgagagtccgaaag
cagtgtgccctcgctgccttgagagacgtcaaaagttacctgacgaaggaagggggccaa
atttcagttttcgatgccaccaatactactagagagaggagacacatgatccttaatttt
gccaaagaaaatgatttcaaggtgtttttcatcgagtcagtgtgcgatgaccctacagtt
gtggcctccaacattagggaagtgaaaatctccagcccggattacaaagactgcaactca
gcagaggccatggaggacttcatgaagagaattaactgctatgaagccagctatcagccc
ctcgaccccgacaaatgtgacagggacctgtccttgatcaaggtgatcgacgtgggccgg
cggttcttggtgaacagagttcaggaccacattcagagccgaattgtgtactacctgatg
aacatccacgtgcagccccgcaccatctacctgtgtcggcacggagagagcgagcacaac
ctccaggggaagatcggaggggactcaggcctgtccgtcaggggcaggaagtttgccaac
gccctgagcaaatttgtggaggagcagaacctgaaggacctcaaggtgtgggccagccag
ctgaagagcaccatccagacggcagaagcccttcagcttccctatgaacagtggaaagcg
ctcaacgaaatcgatgctggtgtctgcgaggagatgacctacgaggagatcaaggacacc
taccctgaggagtacgctctgcgcgagcaggacaagtactactaccggtaccccactggg
gagtcctaccaggacctggtccagcgcctggagccagtgatcatggagctggagcggcag
gagaatgtgctggtgatctgccaccaggctgtcctgcgctgcctgctggcctacttcctg
gataagagtgcagaggaaatgccttacctgagatgcccccttcacaccgtcctgaagctg
acgccagtcgcttacggctgccgtgtagaatccatctacctgaatgtggagtccgtgaac
acacaccgggagaggtcagaggacgcaaagaagggacctaacccactcatgagacgcaat
agtgtcaccccactagccagccccgagcccaccaaaaagcctcgcatcaacagctttgag
gagcatgtggcctctacctccgctgccctgcccaactgcctgcccccggaggtgcccgcg
cagctgcctggacaacctttgctagggaaagcctgtttgccagtggcatttcttctcatg
aacagcaggagcatcaagaggttggggagtgggggaacccctgggatcttaagggctgtg
gttggaggatgcccgtaa

KEGG   Myotis brandtii (Brandt's bat): 102256384Help
Entry
102256384         CDS       T02920                                 

Gene name
PFKFB4
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  KO
K19030  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 4 [EC:2.7.1.105 3.1.3.46]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00051  Fructose and mannose metabolism
myb04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102256384 (PFKFB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102256384 (PFKFB4)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     102256384 (PFKFB4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     102256384 (PFKFB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 Shisa Prefoldin His_Phos_2 AAA_33
Motif
Other DBs
NCBI-GeneID: 102256384
NCBI-ProteinID: XP_014394464
Position
Un
AA seq 631 aa AA seqDB search
MSHSSVHSGLTLPESGQLPREGSVPGALCKQQPEPRAPLLLRALCRVPQPLRVQGLAGRA
PALRTTRHCVDGFTVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQV
KLGSPDYVNRDSEEAAEDFLRRIECYESSYESLDEDLDRWALGTAPLCSAWHRGLSYIKI
MDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESEFNLKGRIGGDPGLSPRG
REFARSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYE
EIQDHYPLEFALRDQDKYRYRYPKGEVGGTPGLSPLGGGRRSLSQTAHPHRPPASLTVTC
PCQSGCKVESIFLNVGAVNTHRERPQVEEVERRSYWGGWALHPSSLAPPEGESVAAHTWV
SNVQLNASPQPATVVGVSGDRLVPLGTFPGRTLNCRSCWRALALCCGGFRMRGNTAVASR
WEDADLVSPRVLGRCPHVCPEALSSPRPAGGPLSHSVAESPGPRGHTHCPGTRSGPAGLC
RGDTVGVTVAPAHSEVCMLAGGDSFSPKTCPMFCCGTCYNQYCCSDILKSVWNKEGCADN
QDSLASVRNNMVETFPSSLKYTDIDTDPLPG
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagttcagttcactcgggcctgaccctccccgagtcaggtcagctcccaagg
gagggctcagtccccggcgccctctgcaaacagcagccagagccccgggcgcccctgctc
ctccgggccctgtgccgggttcctcagcctctccgggtccagggactggctggacgcgct
cccgcgctcaggaccacacgtcactgcgttgacgggttcacggttttcgatgcaacaaac
accacccgagagcggagggcgaccatctttaattttggggagcagaacggctacaagacc
ttcttcgttgagtccatctgtgtggatcccgaggtcatcgcggccaacatcgtgcaagtg
aagctgggcagccctgactacgtcaaccgcgacagcgaggaggcggcggaggacttcctg
aggcgcatcgagtgctacgagagctcctacgagtccctggacgaggacctggacaggtgg
gcgctcgggacagcccctctctgctccgcttggcacaggggtctgtcctacatcaagatc
atggacgtggggcagagctacgtggtgaaccgcgtggccgaccacatccagagccgcatc
gtgtactacctcatgaacatccacgtgaccccgcgctccatctacctctgccggcacggc
gagagcgagttcaacctcaagggccgcatcggcggggacccgggactgtccccgcggggc
agggagtttgccaggagtctggcccagttcatcagcgaccagaacatcaaggacctgaag
gtgtggaccagccagatgaagcggaccatccagacagccgaggcgctgggcgtgccctac
gagcagtggaaggtcctcaacgagatcgacgcgggcgtctgtgaggaaatgacctacgag
gaaatccaggatcactatcccctggagtttgccctgcgggaccaggacaagtaccggtac
cgctaccccaagggggaggtaggtgggactccgggcctgtcccccctgggcggggggagg
agatccctttcccagacggcccatcctcaccggcccccagcgtccctcacggtgacatgt
ccctgtcagtctggttgtaaggtggagtccatcttcctgaacgtgggggctgtgaacacg
caccgggagaggccgcaggtggaggaggtggagaggaggtcctactggggcgggtgggcc
ctccatccaagctccctggcgcctccagagggcgagagcgtggccgcacacacctgggtt
tccaacgtccagctgaacgcctctccccagccggccacagtcgttggcgtctcgggggac
cggctggttccactggggacctttccaggcagaaccctgaactgccggtcctgctggcgg
gcactggccctgtgctgcggtggcttcaggatgcgtgggaacacggccgtagcatctcgc
tgggaggatgcagacctcgtgtcacccagagtcctgggccgttgtccacacgtgtgtcct
gaggctctgtcctcaccccggccagcgggaggccctttatcccactctgtggccgagagc
cctggcccccgagggcacacgcattgcccaggcacccgctcaggccccgcagggctgtgc
cgcggggacactgtgggtgtgactgtagcccctgcccacagcgaggtgtgcatgttggcc
ggtggagacagcttctcccccaagacctgccccatgttctgctgcggcacctgctacaac
cagtactgctgctccgacatcctgaagtccgtctggaacaaggaaggctgtgccgacaat
caggacagcttggccagtgtcaggaataacatggtggagacgtttccctcctcgctgaag
tacaccgacatagacaccgaccccctgccagggtaa

DBGET integrated database retrieval system