KEGG   Myotis brandtii (Brandt's bat): 102242927Help
Entry
102242927         CDS       T02920                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00071  Fatty acid degradation
myb01212  Fatty acid metabolism
myb03320  PPAR signaling pathway
myb04152  AMPK signaling pathway
myb04714  Thermogenesis
myb04920  Adipocytokine signaling pathway
myb04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102242927 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102242927 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102242927 (CPT1C)
   04920 Adipocytokine signaling pathway
    102242927 (CPT1C)
   03320 PPAR signaling pathway
    102242927 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    102242927 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:myb03029]
    102242927 (CPT1C)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102242927 (CPT1C)
Mitochondrial biogenesis [BR:myb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102242927 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102242927
NCBI-ProteinID: XP_014405925
Position
Un
AA seq 684 aa AA seqDB search
MAEAHQAVGFRPSLTSDGAEADLSASALQDIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLTEKIKELLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTAGLAQEFLRLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLNRQEILPTLLMGMR
PLCSAQYEKIFNTTRVPGTQKGETLSPLLALGGGTVWRGHDRWYDKSFTLIVFSNGKLGL
SVEHSWADCPVSGHMWEFTLATECFQLGYSVDGHCKGHPEPSLPRPQRLHWDLPDKVHLS
IALALRAAKTLSGDTDCHVFPFSHFGKSFIKRCHLSSDSFIQVALQLAHFRDRGHFCLTY
ESAMTRLFLEGRTETVRSCTREACNFVRAMEDREKTDSQCLSLFRLAVDKHQALLKAAMS
GQGVDRHLFALHIVSQLLHLQAPFLDQVHSEQWQLATSQIPVQQTHLFDVHNYPDYVSSG
GGFGPVDDHGYGVSYIFMGDDTVTFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQEGQ
RLKRGCRGRGEEDAGNRRGSLPGH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaagccgtgggcttccgaccctcactgacctcggacggggcggaa
gcggacctcagtgcctcggcgctgcaggacatctacctgtccggactgcgctcctggaaa
aggcatctctcccggttctggaatgactttctcactggtgtgttccctgccagccccctc
agctggctcttcctcttcagtgcaatccagctcgcctggttcctccagctggatccttcc
ctgggactgacggagaagattaaagagttgctgccagattggggtggacagcaccacagg
cttcgcggggtcctggcggccgcactgtttgcttcctgcctctggggagccctgatcttc
acacttcacgtggctctcaggctgctgctgtcctaccacggctggctcctcgaaccccac
ggagccatgtcctcacccaccaagacttggctggccctggtccgcatcttctccggccgc
cacccaatgctcttcagttaccagcgctccctgccgcgccagccagtgccctcggtgcag
gacaccgtgcgcaagtacctggagtccgtccggcctgtcctttcggacgaggatttcgac
tggacggcgggcctggctcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagagttcgtg
taccttcgctcccgcaactcgctgatggtgaatagcaactattatatgatggacttcctg
tatgtcacgcccacacccgtgcaggctgctcgcgctgggaacgctgtgcacgccctgctc
ctctaccgccaccgcctgaaccgccaggagatcctgccgacgttgctgatgggaatgcgg
cccttgtgctccgcccagtatgagaagatattcaacaccacgcgggtgcctgggacccag
aaaggtgagaccctctctcccctcctggctctgggaggcgggacagtctggcggggccac
gaccgctggtatgacaagtccttcaccctcatcgtcttctccaacggcaagctgggcctc
agcgtggagcactcgtgggcggactgccccgtctcagggcacatgtgggagttcactctg
gccaccgaatgcttccagctgggctactcggtggacggccactgcaagggccatcctgag
ccctccctgccccggccccagcggctacactgggaccttccagacaaggtccacctgtcc
atcgcgctcgccctgagggcagccaagaccttgtccggagacacggactgccacgtcttc
cccttctcccacttcggcaagagcttcatcaagcgctgccacctgtcctcagacagcttc
atccaggtggccttgcagctggcccacttccgggacaggggtcacttctgcctgacttat
gagtcagccatgacgcgcctgttcctggaaggccggacggagacggtgcggtcttgcacg
cgggaagcctgcaacttcgtgcgagccatggaggacagagagaagacagactcccagtgc
ctctccctgttccgcctggcggtggacaagcaccaggctctgctgaaggcggccatgagc
gggcagggcgtggaccgccacctgttcgcactccacatcgtgtcccagctcctccacctg
caggcgcccttcctggaccaggttcactcggagcagtggcagctggccaccagccagatc
cctgtgcagcaaacccacctgtttgacgtccacaactaccccgactacgtgtcctccggt
ggagggtttgggcctgtggatgaccacggctacggtgtttcttacatcttcatgggggat
gacacggtcaccttccacatttccagcaaaaaatcaagcacaaaaacggactcccaccgg
ctggggcagcacattgaggacgcgctgctggacgtggcctccctgttccaggaggggcag
cgtctgaagcgagggtgccgggggcggggggaggaggacgcggggaaccggcgtgggtct
ctccccggccactag

DBGET integrated database retrieval system