KEGG   Myotis brandtii (Brandt's bat): 102243479Help
Entry
102243479         CDS       T02920                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00020  Citrate cycle (TCA cycle)
myb00480  Glutathione metabolism
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb01210  2-Oxocarboxylic acid metabolism
myb01230  Biosynthesis of amino acids
myb04146  Peroxisome
Module
myb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102243479 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102243479 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102243479 (IDH1)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     102243479 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 102243479
NCBI-ProteinID: XP_005874270
Position
Un
AA seq 414 aa AA seqDB search
MSQKIHGGSVVEMQGDEMTRIIWELIKEKLIFPYVDLDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGSPKKTYVVHNFEEGGGVAM
GMYNQDKSIKEFAHSSFQMALSKSWPLYLSTKNTILKKYDGRFKDIFQEIYEKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMHQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELGFFAKALE
DVCVETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaaaatccatggcggttcagtggtagagatgcaaggagatgaaatgacacga
attatttgggagttgattaaagaaaaactcatttttccttatgtggacctggatctgcac
agctatgatttaggcattgagaatcgtgatgccaccaacgaccaggtcaccaaggatgcc
gcagaagctataaagaagtacaacgttggcgtcaagtgtgccaccatcacccccgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaagtcgcccaatggcaccatccga
aatattctgggtggtactgtcttcagggaagctattatctgtaaaaacatcccccggctt
gtgagcggatgggtgaaacccatcatcataggtcgtcatgcgtatggggatcagtacaga
gcaactgattttgttgttcccgggcctggaaaagtagagataacctacacgccaagtgat
ggatccccaaaaaagacatacgtggtacataactttgaagagggtggtggtgttgccatg
gggatgtacaatcaagataagtcaatcaaagagttcgcacacagttctttccagatggct
ttgtccaagagttggcctttgtacctgagcaccaaaaacactattctgaagaaatatgat
gggcgttttaaagacatctttcaggagatctatgagaagcagtacaaatcccagtttgag
gcccagaagatctggtatgagcacaggctcatcgatgacatggtggcccaagccatgaag
tcggaggggggcttcatctgggcctgtaaaaactacgatggcgacgtgcagtccgactcc
gtggcccagggttatggctctctgggcatgatgaccagcgtgctgatttgtccagacggc
aagacggtggaagcagaggccgcccacgggactgtcacacgtcactaccgcatgcaccag
aaggggcaggagacatctaccaatcccattgcttccatttttgcctggaccagggggtta
gcccacagagctaagcttgataacaacaaagagctcggcttctttgcaaaggctttggaa
gacgtctgtgtggagaccatcgaggctggcttcatgaccaaggacttggctgcttgtatt
aaaggtttgcccaacgtgcagcgttctgactacttgaatacgtttgagttcatggacaaa
ctcggagaaaacttgaagataaaactagctcaggccaaactttaa

DBGET integrated database retrieval system