KEGG   Myotis brandtii (Brandt's bat): 102245131Help
Entry
102245131         CDS       T02920                                 

Definition
(RefSeq) cytochrome P450 2B11
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00140  Steroid hormone biosynthesis
myb00590  Arachidonic acid metabolism
myb00830  Retinol metabolism
myb01100  Metabolic pathways
myb05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102245131
   00590 Arachidonic acid metabolism
    102245131
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102245131
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102245131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:myb00199]
    102245131
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102245131
Cytochrome P450 [BR:myb00199]
 Cytochrome P450, animal type
  CYP2 family
   102245131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102245131
NCBI-ProteinID: XP_005868839
Position
Un
AA seq 491 aa AA seqDB search
MELSVLLLLALITGLLILLARGHPKAHGHLPPGPRPLPFFGNLLQMDRRGLLKSFLRLRD
KYGDVFTVYLGPRPVVILCGAEAIREALVDQAEAFSGRGKIAVIDQVFQGYGVVFANGER
WKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELQKSQGALQDPTLIFHSITANIIC
SIVFGRRFAYRDPDFLKLLDMFYQSFALISSFSSQVFELFSDFLKYFPGTHRQIYRNMQE
VKDFIGHSVEKHRETLDPNAPRDFIDTYLLRMDKEKSHPNSEFHHQNLINTVLSLFFAGT
ETTSTTLRYGFLLMLKYPHIAEKVHKEINQVIGSHRPPALDDRAKMPYTEAVIHEIQRFG
DLIPIGVPHVVIKDTKFRGYNIPKDTEVYPILNSALFDSRYFDTPDTFNPNHFLDANGAL
KKNEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSVASPMAPEDIDLTPRECGVGKL
PPVYQIRFLSR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagtgtcctcctcctccttgctctcatcacaggactattgattctcctggcc
aggggccacccaaaggcacatggccaccttccgccaggcccccgtcctctgcccttcttc
gggaaccttctgcagatggacagacgaggcctactcaaatccttcctgaggctccgagac
aaatatggggatgtcttcacggtgtacctggggccaaggcctgtggtcatactatgtggg
gcagaggcaatccgggaggccctggtggaccaagctgaggccttttctggccgggggaaa
atcgccgttattgatcaagtctttcaaggatatggtgtggtgtttgccaatggggaacgc
tggaaggctcttcggcgattttctctggccaccatgagggacttcgggatgggcaagcgg
agtgtggaggaacggattcaggaggaggcgcagtgtctggtggaggagcttcagaaatcc
cagggagccctccaggaccccaccttgatcttccactccatcactgccaacatcatctgc
tccattgtctttggaagacgctttgcctacagagaccctgattttctgaagcttctggac
atgttctaccagtccttcgcactcatcagctccttctccagccaggtgtttgagctcttc
tctgacttcttgaagtactttcctggcacacacaggcaaatctacagaaacatgcaggaa
gtcaaagactttattggccacagtgtggagaagcacagggagaccctggaccccaacgcc
ccccgggacttcattgatacctacctgctccgcatggacaaagagaagtcccacccgaac
agcgagttccaccaccagaacctcatcaacaccgtactctctctcttctttgcgggcacg
gagaccaccagcaccactctccgctatggattcctgctaatgctcaaatatccccacatc
gcagagaaagtccacaaggagattaatcaggtgattggctcacatcgccctccagccctt
gatgaccgggccaaaatgccatacactgaagcagtcatccacgagattcagagattcgga
gacctgatccctattggtgtgccccacgtggtcatcaaagacactaaattccgagggtac
aacatcccaaaggacactgaagtatatcccatcctgaactctgctctctttgactcacgt
tactttgacacaccagacaccttcaaccctaaccactttctggatgccaatggggcactg
aagaagaatgaagcttttatacccttctccctagggaagcgcatttgtcttggcgaaggt
atagcccgtgcggaattattcctcttcttcaccaccatcctccagaatttctccgtggcc
agtcccatggcccctgaggacattgacctcacaccccgggagtgtggagtgggcaagctg
cccccagtgtaccagatccgattcctgtcccgctga

DBGET integrated database retrieval system