KEGG   Myotis brandtii (Brandt's bat): 102245701Help
Entry
102245701         CDS       T02920                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04218  Cellular senescence
myb04370  VEGF signaling pathway
myb04625  C-type lectin receptor signaling pathway
myb04722  Neurotrophin signaling pathway
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102245701
   04370 VEGF signaling pathway
    102245701
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102245701
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102245701
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102245701
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102245701
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102245701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102245701
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102245701
Protein kinases [BR:myb01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102245701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102245701
NCBI-ProteinID: XP_005885288
Position
Un
AA seq 307 aa AA seqDB search
MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR
GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKE
TTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISP
GMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQ
TPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAL
EAAALAH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggactgccccaaggcccggcgcgaggtggagctgcactggcgggcctcccag
tgcccacacatcgtgcgcatcgtggacgtctatgagaacctgtacgcggggaggaagtgc
ctgctcatcgtcatggagtgcttggatggtggagaactcttcagccgaatccaggaccga
ggagaccaggcgttcacagaaagagaagcttcagaaatcatgaagagcatcggtgaggcc
attcagtatttgcactcaatcaacattgctcatcgggatgtcaagcccgagaacctctta
tacacctccaaaaggcccaacgccatcctgaaactcaccgattttggctttgccaaggaa
accaccagccacaactcgttgaccactccttgttatacgccttattatgtggctccagaa
gtgctgggcccagagaagtacgacaagtcctgtgatatgtggtccttgggtgtcatcatg
tacatcctgctgtgtgggtacccaccgttctattccaaccatggccttgccatctctccg
ggcatgaagacgcgcatccgaatgggccagtatgagtttcccaacccagagtggtcagaa
gtatcagaggaagtgaagatgctcatccggaacctgctgaaaacagagcccactcagaga
atgaccatcacggagttcatgaaccacccctggatcatgcaatcaacaaaggtccctcaa
accccactgcacaccagccgggtcctgaaggaggacaaggagcggtgggaggatgtcaag
gaggagatgaccagtgccttggccacaatgcgtgttgactacgagcagatcaagataaaa
aagatagaagatgcctccaaccctctgcttctgaagaggcggaagaaggctcgggccctg
gaggctgcggccctcgctcactga

DBGET integrated database retrieval system