KEGG   Myotis brandtii (Brandt's bat): 102246003
Entry
102246003         CDS       T02920                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00230  Purine metabolism
myb00240  Pyrimidine metabolism
myb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102246003
   00240 Pyrimidine metabolism
    102246003
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102246003
SSDB
Motif
Pfam: dNK PRK AAA_28 CoaE
Other DBs
NCBI-GeneID: 102246003
NCBI-ProteinID: XP_014387837
Position
Un
AA seq 196 aa
MATPPKKSCPSPETSSEGTRIKTISIEGNITAGKSTFVNILKQVFQDCEVVPELIARWCN
VKSTQDEFQELTTSQNSDGNVLQMMYEKPERWSFTFQENACLSRIRAQLDSLNGKIKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
SPEVRLNKHLLVPLKI
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccaccccacctaagaagagctgcccctctcccgagaccagctcggagggaacccgc
atcaagacaatttccatcgaagggaacatcactgcagggaagtcaacatttgtgaatatc
cttaaacaagtcttccaggattgtgaagtggttcctgaacttattgccagatggtgcaat
gttaaaagtactcaagatgaatttcaggaactgaccacatctcagaatagtgatgggaat
gttcttcagatgatgtatgagaaacctgagcgatggtcttttaccttccaggaaaatgcc
tgcctcagtcgcatacgagctcagcttgactctctcaacggcaagatcaaagatgcggag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgtatgaatgaaacagagtggacaatttatcaggactggcatgac
tggatgaataaccaatttggccaaagccttgaactggatggaatcatttatcttcgagct
agtccagaggtgagacttaataaacatttgcttgttcctttgaaaatttaa

DBGET integrated database retrieval system