KEGG   Myotis brandtii (Brandt's bat): 102246057Help
Entry
102246057         CDS       T02920                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01040  Biosynthesis of unsaturated fatty acids
myb01212  Fatty acid metabolism
myb03320  PPAR signaling pathway
myb04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102246057 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102246057 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102246057 (SCD5)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102246057 (SCD5)
Lipid biosynthesis proteins [BR:myb01004]
 Desaturase
  First
   102246057 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102246057
NCBI-ProteinID: XP_014400086
Position
Un
AA seq 258 aa AA seqDB search
CLCLAAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWSRDHR
VHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRHLDVTDLLADPVVRFQRKYY
KISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYAISLNVTWLVNSAAHMYGNRPYDK
HISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDIMCWLGLATDRKR
ATKPMIEARKARTGDGSA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
tgcttgtgccttgcagcctacttctgcttcctcctgactgctctgggtgtgacagctggt
gcccatcgcttgtggagccacaggtcctacaaggccaagctgcctctgagaatatttctg
gctgccgccaactccatggctttccagaacgacatcttcgagtggtccagggaccatcga
gtccaccacaagtactcggagactgacgctgacccccacaacgcccgccggggcttcttc
ttttcccacatcgggtggctgtttgttcggaagcatcgagatgtcattgagaaggggaga
caccttgatgtcactgacctgctggctgatcctgtggtccggttccagagaaagtactac
aagatctccgtggtgctcatgtgctttgtggtccccacactggtgccctggtacatctgg
ggagagagtctgtggaattcctacttcctggcctccatccttcgctatgccatctcactc
aacgtcacctggctggtcaacagtgccgcccacatgtatggaaaccggccctacgacaag
cacatcagcccgcggcagaacccgctggtcacactgggcgccattggcgaaggcttccac
aattaccatcacacctttccctttgactattctgcgagtgaatttggcttaaatttcaac
ccgaccacctggttcattgacatcatgtgctggctggggctggccactgaccgcaaaagg
gcaaccaagccgatgatcgaggcccggaaagccaggactggagatggcagcgcttga

DBGET integrated database retrieval system