KEGG   Myotis brandtii (Brandt's bat): 102246728Help
Entry
102246728         CDS       T02920                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb04062  Chemokine signaling pathway
myb04068  FoxO signaling pathway
myb04137  Mitophagy - animal
myb04151  PI3K-Akt signaling pathway
myb04152  AMPK signaling pathway
myb04211  Longevity regulating pathway
myb04213  Longevity regulating pathway - multiple species
myb04218  Cellular senescence
myb04722  Neurotrophin signaling pathway
myb04917  Prolactin signaling pathway
myb05213  Endometrial cancer
myb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102246728 (FOXO3)
   04151 PI3K-Akt signaling pathway
    102246728 (FOXO3)
   04152 AMPK signaling pathway
    102246728 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102246728 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    102246728 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102246728 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102246728 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102246728 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    102246728 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    102246728 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    102246728 (FOXO3)
   05223 Non-small cell lung cancer
    102246728 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102246728 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102246728 (FOXO3)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    102246728 (FOXO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg FOXO-TAD Forkhead
Motif
Other DBs
NCBI-GeneID: 102246728
NCBI-ProteinID: XP_005883882
UniProt: S7QC15
Position
Un
AA seq 487 aa AA seqDB search
MVRCVPYFNDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKA
PRRRAVSMDNSNKYTKSRSRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAW
TDFRSRTNSNASTVSGRLSPILAGTELDDVQDDDAPLSPMLYSSSASLSPSVSKPCTVEL
PRLTDMAGTMNLNDGLADNLMDDLLDNIPLPPSQPSPAAGLMQRSSSFPYTTKGSGLGSP
TSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMPHYGTQTLQDLLTSDSLSHSDVMM
TQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALSG
SRALSNSVSNMGLSDSSSLGSAKHQQQSLVSQSMQTLSDSLSGSSLYSTSANLSVMGHEK
FPSDLDLDMFNGSLECDMESIIRSDLMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQAS
SQSWVPG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgctgcgtgccctacttcaatgataagggcgacagcaacagctctgcgggctgg
aagaattctatccgacacaacctctcgctacacagccggttcatgcgggtccagaatgag
gggactggcaagagctcttggtggatcatcaaccccgacggagggaagagcgggaaggca
ccccgccggcgggctgtctccatggacaacagcaacaagtataccaagagccgtagccgt
gcagccaagaagaaggcagccctgcaaacagctcctgagtcagcagacgacagtccctcc
cagctctccaaatggcctggcagccccacatctcgcagcagcgatgagctggatgcatgg
acggattttcgctcgcgcaccaattccaatgccagcacggtcagcggtcgcctatcaccc
atcctggcgggcacagagctggatgacgtccaggatgacgacgcgccactctcccccatg
ctttatagcagctcagccagcctctcaccctccgtcagcaagccgtgcacggtggagctg
ccccggctgaccgacatggcaggcaccatgaatctgaatgatggtctggctgacaacctc
atggatgacctgctggataacatcccgctcccaccgtcccagccgtcccccgccgcgggg
ctcatgcagaggagctctagcttcccatacaccaccaagggctccggcctgggctctcca
accagctccttcaacagcacagtgtttggaccctcatctctgaattccctgcgccagtct
cctatgcagaccatccaagagaacaagccagccaccttctcttccatgccgcactatggc
acccagacactccaggacctgctcacttcagactcactcagccacagcgatgtcatgatg
acccagtcggaccccttgatgtctcaggccagcaccgctgtgtctgcccagaactcccgc
cggaatgtgatgcttcgcaatgacccaatgatgtcctttgcagcccagcctaaccagggg
agtttggtcaatcagaacttgctccaccaccagcaccagacccagggcgctctcagcggc
agccgtgccttgtcgaattctgtcagcaacatgggcttgagcgattccagcagccttggg
tcagccaaacaccagcagcagtctcttgtcagccagtctatgcaaaccctctcggactct
ctctcaggctcctctttgtactcaacgagtgcaaacctttccgtcatgggccacgagaag
ttccccagcgacctggacctggacatgttcaatgggagcttggaatgtgacatggagtcc
attattcgcagtgacctcatggatgccgatgggttggattttaactttgattccctcatc
tccacacagaacgttgttggtttgaacgtggggaacttcactggtgctaagcaggcctca
tctcagagctgggtgccaggctga

KEGG   Myotis brandtii (Brandt's bat): 102253962Help
Entry
102253962         CDS       T02920                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box O1
  KO
K07201  forkhead box protein O1
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04068  FoxO signaling pathway
myb04152  AMPK signaling pathway
myb04211  Longevity regulating pathway
myb04213  Longevity regulating pathway - multiple species
myb04218  Cellular senescence
myb04910  Insulin signaling pathway
myb04919  Thyroid hormone signaling pathway
myb04922  Glucagon signaling pathway
myb04931  Insulin resistance
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb05165  Human papillomavirus infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102253962 (FOXO1)
   04152 AMPK signaling pathway
    102253962 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102253962 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102253962 (FOXO1)
   04922 Glucagon signaling pathway
    102253962 (FOXO1)
   04919 Thyroid hormone signaling pathway
    102253962 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    102253962 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    102253962 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102253962 (FOXO1)
   05202 Transcriptional misregulation in cancer
    102253962 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102253962 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102253962 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102253962 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102253962 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102253962 (FOXO1)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    102253962 (FOXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 102253962
NCBI-ProteinID: XP_005862824
Position
Un
AA seq 533 aa AA seqDB search
MAEAPQVVEIDPDFEPLPRPRSCTWPLPREDSSRRNAWGNLSYADLITKAIESSAEKRLT
LSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPE
GGKSGKSPRRRAASMDNNSKFSKSRGRAAKKKASLQSGPEGAGDSPGSQFSKWPASPGSH
SNDDFDNWNTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSMVYPPSAAKMASTLPSL
SEISNPENMENLLDNLNLLSSPPSLTVSTQSSPGAMMQQTPCYSFAPPNTSLNSPSPNYQ
KYTYGQSSMSPLPQMSMQTLQDNKSSYGGMNQYNCAPGLLKELLTSDSPPHNDIMAPVDP
GVAQPNSRVLGQNVLMGPNPVMPSYGSQASHNKMMNPSSHSHPGHAQPTSVVNGRALPHA
VNTMPHTSGMNRLAPVKTALQVPLPHPMQMNALGGYSSMSSCNGYGRMGILHQEKLPSDL
DGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagattgatccggacttcgagccgctgccgcggcca
cgttcgtgcacctggccgctgcccagggaggactcgtcccggcgcaacgcgtggggcaac
ttgtcctacgccgacctcatcaccaaggccatcgagagctcggctgagaagcggctcacg
ctgtcgcagatctacgagtggatggtcaagagtgtgccctacttcaaggataagggcgac
agcaacagttcggcgggctggaagaattcaattcgtcataatctgtccctgcacagcaag
ttcatccgtgtgcaaaatgaaggaactggaaaaagttcttggtggatgctcaacccagaa
ggaggcaagagtggaaaatcccccaggagaagagctgcatccatggacaacaacagtaaa
ttttccaagagccgaggccgagccgccaagaaaaaagcatccctccagtctggtccagag
ggtgccggggacagcccagggtctcaattctccaagtggcctgccagccctggctctcac
agcaatgacgactttgataactggaacacatttcgccctcgaactagctcaaatgctagt
actattagtgggagactttctccaattatgaccgaacaggatgatcttggagatggcgat
gtgcattcaatggtgtacccaccctccgctgcaaagatggcttctactctgcccagtctg
tcagagataagcaatcccgaaaacatggaaaaccttttggataatctcaacctcctgtca
tcaccaccgtcattaactgtttcaacccaatcttcacctggtgccatgatgcaacagaca
ccatgctactcgtttgcaccgccaaacaccagcttgaattcacccagtccaaactaccaa
aaatatacctatggccaatccagcatgagccccttgccccagatgtcaatgcaaacactt
caggacaataaatcgagctatggaggtatgaatcagtataattgtgcaccaggactcttg
aaggagttacttacttctgactctcctccccataatgacattatggcaccagttgatcct
ggggtggctcagcctaacagtagggtcctgggccagaatgtgttgatgggccctaatccg
gtcatgccaagctatggcagccaggcatctcataacaaaatgatgaatcccagctcccat
tcccaccctggacatgctcagccaacgtctgtagttaatgggcgtgccttgccccacgca
gtaaacaccatgccccacacctcgggcatgaaccgcttggccccagtgaagacagcttta
caagtgcctctgcctcaccccatgcagatgaacgcccttgggggctactcttccatgagc
agctgcaacggctatggcaggatgggcattctccaccaggagaagctcccgagtgacttg
gacggcatgtttattgagcgcttggactgtgacatggaatccatcattcggaacgacctc
atggatggagatactttggattttaattttgacaatgtgttgcccaaccaaagcttccca
catagtgtcaagacgacaacacatagctgggtgtcaggctaa

DBGET integrated database retrieval system