KEGG   Myotis brandtii (Brandt's bat): 102247996
Entry
102247996         CDS       T02920                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00230  Purine metabolism
myb01100  Metabolic pathways
myb01522  Endocrine resistance
myb04015  Rap1 signaling pathway
myb04020  Calcium signaling pathway
myb04022  cGMP-PKG signaling pathway
myb04024  cAMP signaling pathway
myb04062  Chemokine signaling pathway
myb04072  Phospholipase D signaling pathway
myb04114  Oocyte meiosis
myb04211  Longevity regulating pathway
myb04213  Longevity regulating pathway - multiple species
myb04261  Adrenergic signaling in cardiomyocytes
myb04270  Vascular smooth muscle contraction
myb04371  Apelin signaling pathway
myb04540  Gap junction
myb04611  Platelet activation
myb04713  Circadian entrainment
myb04714  Thermogenesis
myb04723  Retrograde endocannabinoid signaling
myb04724  Glutamatergic synapse
myb04725  Cholinergic synapse
myb04727  GABAergic synapse
myb04742  Taste transduction
myb04750  Inflammatory mediator regulation of TRP channels
myb04911  Insulin secretion
myb04912  GnRH signaling pathway
myb04913  Ovarian steroidogenesis
myb04914  Progesterone-mediated oocyte maturation
myb04915  Estrogen signaling pathway
myb04916  Melanogenesis
myb04918  Thyroid hormone synthesis
myb04921  Oxytocin signaling pathway
myb04923  Regulation of lipolysis in adipocytes
myb04925  Aldosterone synthesis and secretion
myb04926  Relaxin signaling pathway
myb04927  Cortisol synthesis and secretion
myb04928  Parathyroid hormone synthesis, secretion and action
myb04934  Cushing syndrome
myb04935  Growth hormone synthesis, secretion and action
myb04970  Salivary secretion
myb04971  Gastric acid secretion
myb04972  Pancreatic secretion
myb04976  Bile secretion
myb05032  Morphine addiction
myb05163  Human cytomegalovirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05200  Pathways in cancer
myb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102247996 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102247996 (ADCY4)
   04371 Apelin signaling pathway
    102247996 (ADCY4)
   04020 Calcium signaling pathway
    102247996 (ADCY4)
   04072 Phospholipase D signaling pathway
    102247996 (ADCY4)
   04024 cAMP signaling pathway
    102247996 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102247996 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102247996 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102247996 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102247996 (ADCY4)
   04062 Chemokine signaling pathway
    102247996 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102247996 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102247996 (ADCY4)
   04912 GnRH signaling pathway
    102247996 (ADCY4)
   04913 Ovarian steroidogenesis
    102247996 (ADCY4)
   04915 Estrogen signaling pathway
    102247996 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102247996 (ADCY4)
   04921 Oxytocin signaling pathway
    102247996 (ADCY4)
   04926 Relaxin signaling pathway
    102247996 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102247996 (ADCY4)
   04918 Thyroid hormone synthesis
    102247996 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102247996 (ADCY4)
   04916 Melanogenesis
    102247996 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102247996 (ADCY4)
   04927 Cortisol synthesis and secretion
    102247996 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102247996 (ADCY4)
   04270 Vascular smooth muscle contraction
    102247996 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102247996 (ADCY4)
   04971 Gastric acid secretion
    102247996 (ADCY4)
   04972 Pancreatic secretion
    102247996 (ADCY4)
   04976 Bile secretion
    102247996 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102247996 (ADCY4)
   04727 GABAergic synapse
    102247996 (ADCY4)
   04725 Cholinergic synapse
    102247996 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102247996 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102247996 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102247996 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102247996 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102247996 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102247996 (ADCY4)
   04714 Thermogenesis
    102247996 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102247996 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102247996 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102247996 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102247996 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102247996 (ADCY4)
   05163 Human cytomegalovirus infection
    102247996 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102247996 (ADCY4)
Enzymes [BR:myb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102247996 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102247996
NCBI-ProteinID: XP_014389772
Position
Un
AA seq 1102 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALPYFVLGFETLFRTGLRSCP
FFLFLDELPKPHTRPSPQELAADPGFLTTVLCALGGFSLLLGLASCEQRLQRWTRPLSGL
VWAALLALGHGFLFTGGVVSAWDQVSFFLFVIFTTYAMLPLGMRDATAAGLTSSLSHLLV
LGLYLGPQRDSRPALLPQLAANAVLFLCGNVAGAYHKALMERALRATFREALSSLHSRRR
LDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVL
YADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLP
DHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTL
ANHMEAGGVPGRVHITGATLALLAGAYAVEDAAIEHRDPYLRELGEPTYLVIDPRAEEED
EKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVESPVSTSTPLPEKALASF
SPQWSLDRSRTPRGLDDEMDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKE
YRLSALPAFKYYAACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFFLLLFVCFSEHL
TRCVLKGPKMLHWLPSLSGLVATRPGLRIALGSATILLIFAMAITSLFFLPAASNCPFRA
TNVSSMAFNLSWELPGSLPLISIPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASC
CLFLHSHAWLSDCLVARLYLGSLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCR
LDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVL
FASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAAT
GLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAG
VIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKG
QLCTYFLNTDLIRVGPPSAALG
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggcccgactcttcagtccccggccgccacccagcgaagacctcttctatgagacctac
tacagcctgagccaacagtacccgctgctgctgctgctgctggtgatcgtgctctgtgcc
ctgccttattttgtacttgggtttgagacacttttcagaactggcctgaggagctgtcca
ttctttctcttcctggacgagctccccaaaccccacacgcgcccctccccacaggagctg
gccgcagacccgggcttcctgaccacagtgctgtgcgcgctgggcggcttctcgctgctg
ctgggcctggcttcctgcgagcagcggctccagcgctggacgcgtccgctgtcgggcctc
gtgtgggcagcgctgcttgcgttaggccatggcttcctattcactgggggcgtggtgagc
gcctgggaccaggtgtcctttttcctctttgtcatcttcactacctatgccatgttgccc
ttgggcatgcgggacgccacagctgcgggcctcacctcctccctctcacacctgctggtc
ctcgggctgtatcttgggcctcaacgagactcaagacctgcgctgctgccgcagttggca
gcaaacgcggtgttgttcctgtgcgggaatgtggcgggagcgtaccacaaggcgctgatg
gagcgcgcgctgcgcgccaccttccgagaggcgctcagttccttgcactcgcgccggcgg
ctggacacggagaagaagcaccaggaacaccttctcttgtccatccttcctgcctacttg
gcccgagagatgaaggcagagatcatggcccggctgcaggctggacaggggtcaaggccg
gagagcaccaacaacttccacagcctctatgtcaagaggcaccagggagtcagcgtgctg
tatgctgacatcgtgggcttcacacggctggccagtgagtgctccccgaaggagttggtg
ctcatgctcaatgagctctttggcaagtttgaccagatcgccaaggagcatgaatgcatg
cggatcaagatcctgggagactgttactactgtgtctccgggctgcccctctccttacca
gaccacgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaaacta
cgagcagccaccggtgtggacatcaacatgcgcgtgggtgtgcactcaggcagcgtgctc
tgtggagtcatcgggctgcagaagtggcagtatgatgtctggtcccatgacgtcacactg
gccaaccacatggaggcaggtggcgtgccaggacgagtacatatcacaggggctaccctg
gccctgctggcaggagcttacgctgtggaggatgcagccatagaacaccgggacccatac
cttcgggagctaggggagcctacgtacctggtcatcgatccccgggctgaggaagaggat
gagaagggcactgcaggagggttgctgtcctctcttgagggccccaagatgcgtccatca
ctgctgatgacccgctacctggaatcctggggtgcagccaagccttttgcccacctgagc
cacgtagagagccctgtgtccacctccactcctctcccggagaaggccctggcttccttc
agcccccagtggagcctggaccggagccgtacaccccggggactagatgatgaaatggac
actggggatgccaagttcttccaagtcatcgaacagctcaactctcagaaacagtggaag
cagtcaaaggacttcaacccactgacactttacttccgagagaaggaaatggagaaagag
tatcgactctctgcactccctgcctttaaatactatgcagcctgcacattcctggttttt
ctctccaacttcatcatccagatgctggtgacaaacaggcccccagctctggccatcacc
tatagcatcaccttcctcctcttcttcctcctcctcttcgtctgcttctcagagcacctg
acgaggtgcgtcttgaaaggccccaagatgctgcactggctgccctcattgtctggcctg
gtggccacacggcctggactgcgaatcgccctgggcagtgccaccatcctcctcatcttt
gccatggccattaccagcctgttcttcttaccggcagcatcaaactgcccttttcgggct
accaatgtgtcctccatggctttcaacctctcctgggagctccctgggtccctgcctctc
atcagtattccatactccatgcactgctgcgtgctgggtttcctctcctgctccctcttt
ctgcacatgagcttcgaactgaagctgctgctgctcctgctatggctggtggcctcctgc
tgcctcttcctgcactcccatgcctggctgtccgactgcctcgtcgcccgcctctatctg
ggctccttggactctaggccaggggtgctgaaggagcccaaactgatgggagctatctct
ttcttcatcttcttcttcacactccttgtcttggctcggcagaatgaatattattgccgc
ctggatttcctgtggaagaagaagctgaggcaggagcgggaggaaacagagacaatggag
aatctgactcggctgctcttggagaacgtgctgcctgcacacgtggccccccagtttatt
ggccagaaccggcgcaatgaggacctctaccaccagtcctatgagtgtgtctgtgtcctc
ttcgcctcagtcccagacttcaaggagttttactctgaatccaacatcaaccacgagggg
ctagagtgtctgcggctgctcaatgagatcattgctgattttgatgagctgctctctaag
cccaagttcagtggggtggagaaaatcaaaaccatcggcagcacctacatggcagctaca
ggcttaaatgccacctctggacaggatgcacagcaggatgctgagcgaagctgcagccac
ctcggcaccatggtggaatttgcagtggcccttgggtctaagctggacgttatcaacaag
cactcattcaacaacttccgcttgcgtgtggggctaaaccatggacctgtagtggccgga
gtgataggagcccagaaaccacaatatgacatctggggcaacacggtgaatgtggccagt
cgcatggagagtacaggagtcctgggcaagatacaagtgactgaggagacagcccgggcc
ctgcagtccttaggctacacctgctacagcaggggtgttatcaaggtcaaaggcaaaggg
cagctgtgtacctacttcctcaacacagatttgataagagttggacctccctcagctgcc
ctaggctga

DBGET integrated database retrieval system