KEGG   Myotis brandtii (Brandt's bat): 102250054
Entry
102250054         CDS       T02920                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102250054 (RDH5)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102250054 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 102250054
NCBI-ProteinID: XP_005876753
Position
Un
AA seq 318 aa
MWLPVLLGVLLWAALWLLRDRQSLPPSNAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRAASSRLHTTLLDVTDPQSVQRAAKWVETYVGETGLFGLVNNAGVAGVIGP
TPWLTRDDFHRVLNVNTLGPIGVTLALLPLLQRARGRVINITSVLGRLAANGGGYCVSKY
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTSVTNLESLENALQACWARLPPATQANYGDA
FLTKYLEVQQHVMNLICDPDLTKVSRCLEHALTACHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctgtgctgctgggagtcttactctgggcagcactgtggctgctcagagac
cggcagagcctgccccccagcaatgccttcgtcttcatcaccggctgtgactctggcttc
gggcggctcctggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctcgggggcagaggacctgcagcgggctgcctcctcccgcctccacaccaccctg
ctggacgtcaccgacccccagagcgtccagcgggcagccaaatgggtggaaacatatgtt
ggggaaacagggcttttcggtctggtgaataatgccggtgtggctggtgtcattgggccc
acaccatggctgaccagggatgacttccaccgggtgctgaatgtgaacacactgggtccc
atcggggtcacccttgccctgctacctttactgcaacgggcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaagtat
ggcctggaggccttctcagacagtctgaggcgggatgtggctccttttggagtacgagtc
tccatcgtggagcctggctttttccgaacctctgtgacaaatctggagagtttggagaac
gccctgcaggcctgctgggcacggctgcctccagccacacaggcaaactatggggatgcc
ttccttaccaagtacctggaagtgcagcagcatgtcatgaacctcatctgtgacccggac
ctgaccaaggtgagcaggtgcctggagcatgccttgactgcttgccaccccagaacccgc
tacagcccaggctgggacgccaagctgctctggctgccagcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaggcagtctcctga

DBGET integrated database retrieval system