KEGG   Myotis brandtii (Brandt's bat): 102252005Help
Entry
102252005         CDS       T02920                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04022  cGMP-PKG signaling pathway
myb04066  HIF-1 signaling pathway
myb04068  FoxO signaling pathway
myb04072  Phospholipase D signaling pathway
myb04150  mTOR signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04152  AMPK signaling pathway
myb04211  Longevity regulating pathway
myb04213  Longevity regulating pathway - multiple species
myb04520  Adherens junction
myb04910  Insulin signaling pathway
myb04913  Ovarian steroidogenesis
myb04923  Regulation of lipolysis in adipocytes
myb04930  Type II diabetes mellitus
myb04931  Insulin resistance
myb04932  Non-alcoholic fatty liver disease (NAFLD)
myb04960  Aldosterone-regulated sodium reabsorption
Module
myb_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102252005 (INSR)
   04015 Rap1 signaling pathway
    102252005 (INSR)
   04010 MAPK signaling pathway
    102252005 (INSR)
   04066 HIF-1 signaling pathway
    102252005 (INSR)
   04068 FoxO signaling pathway
    102252005 (INSR)
   04072 Phospholipase D signaling pathway
    102252005 (INSR)
   04022 cGMP - PKG signaling pathway
    102252005 (INSR)
   04151 PI3K-Akt signaling pathway
    102252005 (INSR)
   04152 AMPK signaling pathway
    102252005 (INSR)
   04150 mTOR signaling pathway
    102252005 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102252005 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102252005 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102252005 (INSR)
   04913 Ovarian Steroidogenesis
    102252005 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102252005 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102252005 (INSR)
   04213 Longevity regulating pathway - multiple species
    102252005 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102252005 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102252005 (INSR)
   04931 Insulin resistance
    102252005 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102252005 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:myb04090]
    102252005 (INSR)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102252005 (INSR)
Protein kinases [BR:myb01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102252005 (INSR)
CD molecules [BR:myb04090]
 Proteins
  102252005 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like
Motif
Other DBs
NCBI-GeneID: 102252005
NCBI-ProteinID: XP_005864960
Position
Un
AA seq 1384 aa AA seqDB search
MYGRGFSQGQDPLSNALPPILKTHHCVLAHLSHFLHIFTLVCPSMDIRNNFTRLYELANC
SIIEGHLQILLMFSSRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSR
LFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNDLCYLATIDWSRILDSVEDNYIV
LNKDDNEECGDVCPGTAKGKTSCPATVINGQFVERCWTHSHCQKVCPTSCKSHGCTAEGL
CCHPECLGSCSEPDDPTKCVACRHFYLDGRCVETCPAPYYHFRDWRCVNFSFCLDLHNKC
KNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHVLEGQKIIDSVTA
AQELRGCTVINGSLTINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLR
LIQGDTLEVGNYSFYALDNQNLRQLWDWSKHNLTITRGKLFFHYNPKLCLSEIHKMEEIS
GTKGRQERTDIALKTNGDQASCENELLKFSYIRTSSDKIMLKWEPYWPPDFRDLLGFMLF
YKEAPYRNVTEFDGQDACGSNSWTVVDIDPPPRSTDPKSQAHPGWLMRSLKPWTQYAIFV
KTLVTFSDERRTYGAKSDIIYIQTNATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNIT
HYLVFWERQEEDSELYELDYCLKGLKLPSRTWSPPSELEGSQKHNQSEYDEAAGECCSCP
KTDSQILKELEESSFRKTFENYLHNVVFVPRKISSGPGAEDSRSSRKRRALGDEGNVTTA
EPTALGFPNTSTIVPTRSEEPRPFEKVVNKESLVISGLRHFTGYRIELQACNQDFPEERC
SVAAYISARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKHPNGLIVLYEVSYRRYGDE
ELHLCVSRRHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEATYFYVTNYLDVPSNI
AKIIIGPLIFVFLFSVVIGSIYLFLRKRQSDGPVGPLYASSNPEYLSASDVFPCSVYVPD
EWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASMRERIEFLNE
ASVMKGFACHHVVRLLGVVSKGQPTLVVMELMTHGDLKSHLRSLRPDAENNPGRPPPTLQ
EMFQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGG
KGLLPVRWMAPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGY
LDIPDNCPERLSELMSMCWHFNPKMRPTFLEVVDLLKDNLHPSFPEVSFFYSEENKAPEN
DELEMEFEDMESVPLDRSSHCQREEDGGCPLALKRNYEDHMSYSHMNGGKKNGRVLTLPR
SSPS
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaggggatttagccaagggcaggaccctctgagcaatgccctgccgccaatt
cttaaaacccaccattgtgtgttagctcacctgtcacactttctgcatatttttactcta
gtgtgtcccagcatggatatccggaacaacttcacgaggctgtatgagctggctaactgc
tcgatcatcgaaggacatttgcagatactgttgatgttcagttcaaggcctgaggatttc
cgagacctcagtttccccaaactcatcatgatcactgattacttgctgctgtttcgggtc
tatgggctggagagcctgaaggacctgttccccaacctcacggtcatccggggctcccgc
ctcttcttcaactacgcgctggtcatcttcgagatggtccacctgaaggagctgggcctc
tacagcctgatgaacatcacccgggggtctgtccgcatcgagaagaacaatgatctctgc
tacctggctaccatcgactggtcgcgcatcctggactcggtggaggataattacatcgtg
ctgaacaaagacgacaatgaagagtgtggggacgtctgtccgggcactgcgaagggcaag
accagctgccctgccactgtcatcaatgggcagtttgtcgaacggtgttggactcacagc
cattgccagaaagtctgcccgaccagctgcaagtcgcacggctgcactgctgaaggcctc
tgctgccaccccgagtgcctgggcagctgctctgagcccgacgaccccaccaagtgcgtg
gcctgccgccacttctacctggacggtaggtgcgtggagacctgcccagccccgtactac
cacttccgggactggcgctgtgtgaacttcagcttctgcctggacctgcacaacaaatgc
aagaactcgcggaggcagggctgccatcagtacgtcattcacaacaacaagtgcattcct
gagtgcccctctgggtacacgatgaattccagcaacttgatgtgcactccgtgtctgggc
ccctgtcccaaggtctgccacgtcctggaaggtcagaagatcatcgactcagtgacagct
gcccaggagcttcgaggatgcaccgtcatcaacgggagcctcaccatcaacatccgtggg
ggcaacaacctggcagctgagcttgaggccaacctcggcctcattgaggaaatttcaggg
tatctgaaaatccgccgttcctacgctctagtgtcactttccttcttccggaagttacgt
ctgattcagggggataccttggaagttgggaactactctttctatgccttggacaaccag
aacctaaggcagctatgggactggagcaaacacaacctcaccataactcgggggaaactc
ttcttccactataatcccaaactctgcttgtcggaaattcacaagatggaagaaatttca
ggaaccaagggacgccaggagaggaccgacattgccctgaagactaatggggaccaggcg
tcctgtgaaaatgaattacttaaattttcttacatccggacatcttctgacaagatcatg
ctgaaatgggagccgtactggccccctgacttccgagacctcctggggttcatgctcttc
tacaaagaggccccttaccggaatgtgacggagtttgatgggcaggatgcgtgtggatcc
aacagctggacggtggtggacattgacccgcctccgaggtccactgaccccaagtcacag
gcccatcctgggtggctgatgcggagtctcaagccctggactcagtatgccatcttcgtg
aagaccttggtcaccttttctgatgaacgccgcacatacggggccaagagcgatatcatc
tatatccagacaaatgccaccaatccttccgtccccttggatcccatctcggtttctaac
tcttcatcccagattatcttgaagtggaagcctccctccgaccccaacggcaacatcaca
cactacctggttttctgggagaggcaggaggaagacagtgagctgtatgagctggattat
tgcctcaaagggttgaagctgccctcccggacctggtccccaccatctgagttggagggt
tcccagaagcacaaccagagcgagtacgacgaggctgccggcgagtgctgctcctgcccg
aagactgactctcagattctgaaggaactggaggagtcctcgttcaggaagacgtttgag
aattacctgcacaatgtggtcttcgtccccagaaaaatctcttcaggccctggtgctgag
gacagtaggtcgtcgagaaaacgcagggcccttggtgatgaagggaacgtgacgacggct
gagcccacagctctgggtttccccaacacctcaaccatcgtgcccacacgctcggaggag
ccgcggcccttcgagaaagtggtgaacaaggagtcgctggtcatctcgggcctgcgccac
ttcactggctaccgcatcgagctgcaggcttgcaaccaggatttccccgaggagaggtgc
agtgtggcggcctacatcagcgccaggaccatgcccgaagccaaggcagatgacattgtt
ggccccgtgacccatgaaatcttcgagaacaacatcgttcatttgatgtggcaggagcca
aagcatccgaacggtctgattgtgctgtatgaagtgagctatcgacgatacggagatgag
gagctgcacctctgtgtgtcccgcaggcacttcgccttggagcggggctgcaggctacgc
gggctgtcgcccgggaattacagcgtgagagtccgggccacctccctggcgggcaatggt
tcctggacagaagccacctatttctatgtgacaaactacttagacgtcccctccaatatt
gcaaaaatcatcatcggccccctcatctttgtcttcctcttcagtgttgtgattggaagt
atttacctattcctgaggaagaggcagtcagacgggccggtgggaccactctatgcttct
tcaaaccctgagtacctcagtgccagcgatgtgttcccatgttctgtgtatgtgccggac
gagtgggaggtgcctcgggagaagatcacgctcctgcgagagctggggcagggctccttc
ggcatggtgtacgagggcaacgccaaggacatcatcaagggcgaggcagagactcgagtg
gcggtgaagacagtcaacgagtcggccagcatgcgggagcggatcgagtttctcaacgag
gcctccgtcatgaaaggcttcgcctgccatcacgtggtgcgcctcctcggggtggtgtcc
aaaggccagcccacactggtggtgatggagctcatgactcacggagacctgaagagccac
ctgcgttccctgcggcctgacgccgagaataaccccggccgccctcccccgaccctgcaa
gagatgtttcagatggcagcggagattgctgacgggatggcatacctgaacgccaagaag
tttgtgcaccgggacctcgcagctcgaaactgcatggtcgcccacgattttaccgtcaaa
attggagactttggaatgaccagagacatctacgaaacggattattaccggaaaggtggc
aaaggtctgcttcctgtgaggtggatggcacctgaatctttgaaggacggggtctttact
gcttcttccgacatgtggtccttcggtgtggtcctgtgggaaatcaccagcttggcagaa
cagccttaccaaggcctctccaatgagcaggtgctgaaattcgttatggatggagggtat
ctggatatccctgacaattgtccagagagactcagtgaattgatgagcatgtgctggcat
ttcaatcccaagatgaggccgaccttcctggaggtcgttgacctgctgaaggacaacctg
caccccagctttccggaagtttccttcttctacagcgaggagaacaaggcacctgagaac
gatgagttggagatggagtttgaggacatggagagtgtacccctggaccggtcctcacac
tgtcagagggaggaggatggggggtgtccgctggccctaaagcggaattacgaggatcac
atgtcctacagccacatgaatgggggcaagaaaaacggacgtgtcctgactctgccacgg
tccagtccttcctaa

DBGET integrated database retrieval system