KEGG   Myotis brandtii (Brandt's bat): 102252196Help
Entry
102252196         CDS       T02920                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00561  Glycerolipid metabolism
myb01100  Metabolic pathways
myb04714  Thermogenesis
myb04723  Retrograde endocannabinoid signaling
myb04923  Regulation of lipolysis in adipocytes
Module
myb_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102252196 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102252196 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102252196 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102252196 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:myb01002]
    102252196 (MGLL)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102252196 (MGLL)
Peptidases [BR:myb01002]
 Serine Peptidases
  Family S33
   102252196 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 PGAP1 Abhydrolase_3 Abhydrolase_5 DLH Thioesterase Peptidase_S9 LIDHydrolase DUF1057 BAAT_C DUF2974 Abhydrolase_2 FSH1
Motif
Other DBs
NCBI-GeneID: 102252196
NCBI-ProteinID: XP_005867012
UniProt: S7MUX2
Position
Un
AA seq 351 aa AA seqDB search
MPRSDLGDEGTALICPALICPALILQAVVAVECPNQDMMETGLGDPFRMPEESSPRRTPQ
NVPYQDLPHLVNADGQYLFCRYWKPAGSPKGLVFVSHGAGEHCGRYDELAQMLVGLQLLV
FAHDHVGHGQSEGERMVVSDFHVFVRDALQHVDAVQKDHPGLPVFLLGHSMGGAIAILTA
AERPSHFSGMVLISPLVLASPESATTFKVLAAKVLNVVLPNMSLGPIDSSVLSRNKTEVD
LYNTDPLICRAGMKVSFGMQLLNAVSRVERALPKLTLPFLLLQGSADRLCDSKGAYLLME
SAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEIKMWVSQRTAAARTGSPP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctctgacctcggcgatgagggaacagcccttatctgcccggccctcatctgc
ccggctctaattctccaggctgtggtggcggtggaatgcccaaaccaggacatgatggaa
acaggacttggagatcctttcagaatgccggaggaaagttctcccaggcggaccccacaa
aacgttccgtaccaggacctccctcatttggtcaacgctgatggacagtacctcttctgc
aggtactggaaacccgccgggtctcccaagggcctcgtctttgtgtcccatggagccggg
gagcactgtggccgctatgatgaactcgctcagatgctggtggggctgcaactgctggtg
ttcgcccatgaccatgtgggccatggacagagcgaaggggagaggatggtagtgtccgac
ttccacgttttcgtcagggatgccttacagcacgtggatgctgtgcagaaagaccacccg
gggctgcccgtcttccttctgggccactccatgggcggtgccatcgccatcctcacggcc
gcggagaggccaagccacttctctggcatggttctcatttcacctttggttctggccagt
cctgagtccgcaacaactttcaaggtccttgctgcgaaggttctcaacgttgtcctacca
aacatgtccctgggcccgatcgactccagcgtgctctctcggaataagacggaggtcgac
ctttataacacggaccccctcatctgccgggcagggatgaaagtgagcttcggcatgcag
ctgctcaatgctgtgtccagggtggagcgggccctccccaagctgaccttgcccttcctg
ctgctccagggctctgctgaccgcctgtgcgacagcaaaggggcctacttgctcatggag
tccgccaagagccaggacaagacactcaagatttacgaaggtgcctaccacgttctccac
aaagagcttcctgaagtaaccaactccgtcttccatgaaataaagatgtgggtctctcaa
aggacagcggcggcgagaacagggtccccaccctga

DBGET integrated database retrieval system