KEGG   Myotis brandtii (Brandt's bat): 102252371Help
Entry
102252371         CDS       T02920                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:myb00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102252371 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102252371 (CREM)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102252371 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 102252371
NCBI-ProteinID: XP_005882368
Position
Un
AA seq 125 aa AA seqDB search
MQKPIMAVTGDETDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQ
QLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLY
CHKAE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacccatcatggctgtaactggagatgaaaccgatgaggaaactgaacttgcc
ccaagtcacatggctgctgccactggtgacatgccaacttaccagatccgagcacctact
actgctttgccacagggagtagtgatggctgcctcaccaggaagtttgcacagcccccag
caacttgcagaagaagccacacgcaaacgagagctgaggctaatgaaaaacagggaagct
gcccgggagtgtcgcaggaagaagaaagaatatgtcaaatgtcttgaaaaccgtgtggct
gtgcttgaaaaccaaaacaagactctcattgaggaactcaaggcccttaaagatctttat
tgccataaagcagagtaa

DBGET integrated database retrieval system