KEGG   Myotis brandtii (Brandt's bat): 102254014Help
Entry
102254014         CDS       T02920                                 

Gene name
ZDHHC9
Definition
(RefSeq) zinc finger DHHC-type containing 9
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102254014 (ZDHHC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC UPF0182
Motif
Other DBs
NCBI-GeneID: 102254014
NCBI-ProteinID: XP_005872783
Position
Un
AA seq 363 aa AA seqDB search
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL
AVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ
RPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN
YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV
GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG
ILPLEESGSRPPSTQETSSSLLPQSPALTEHLSSNEMPEDSTPEEMPPPEPPEPPQEVAE
ADK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatggtggtgagaaagaaggtgacacggaagtgggagaaactcccaggcagg
aacaccttctgctgcgatggccgtgtcatgatggcccggcaaaagggcatcttctacttg
acccttttcctcatcctggggacatgtacactcttctttgccttcgaatgccgttacttg
gctgtccagctatctcctgccatccccgtgtttgctgccatgctcttccttttctccatg
gctacactgttgaggaccagcttcagtgaccctggagtgatccctcgagccctaccagat
gaagcagctttcatagaaatggagatagaagctaccaatggtgcggtgccccagggccaa
cgaccaccccctcgtatcaagaatttccagattaacaaccagattgtaaagctgaaatac
tgttatacgtgcaagatcttccggcctccccgggcctcccattgcagcatctgtgacaac
tgtgtggagcgcttcgaccatcactgcccctgggtggggaattgtgttggaaagaggaac
taccgctacttctacctcttcatcctttctctctccctcctcaccatctatgtcttcgcc
ttcaatatcgtctatgtggccctcaaatccttgaaaattggcttcctggagacgttgaaa
gaaactcctggaactgttctagaagtactcatttgtttcttcacactctggtccgtcgtg
ggactaactggatttcacactttccttgtggctctcaaccagacaaccaatgaagacatc
aaaggctcatggacagggaagaatcgagtccagaatccctacagccatggcaacattgtg
aagaactgctgtgaagtgctgtgtggccccttgccccccagtgtgctggatcgaagaggt
attttaccactggaggaaagcggaagtcgacctcctagcactcaagagaccagtagtagc
ctcttgccacagagcccggccctaacagaacatctgagctcaaatgagatgccggaggac
agcactcctgaagagatgccacccccggaacctccagagccaccacaggaggtggctgaa
gctgacaagtag

DBGET integrated database retrieval system