KEGG   Myotis brandtii (Brandt's bat): 102254475
Entry
102254475         CDS       T02920                                 

Gene name
ACY3
Definition
(RefSeq) aminoacylase 3
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102254475 (ACY3)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102254475 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102254475
NCBI-ProteinID: XP_014393715
Position
Un
AA seq 354 aa
LHPGCQGGCEQVQPAALRRLFKSHECDREPSCLAGTLGLVRPQGAHHPPHPSSAPGPKQA
HPPGPPPTRDGAPGELQPPSFSAVPVLANPAATAACRRYVDCDLNRAFTGAFLTARAHPD
DPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTASTGTCLIAESAHNVFAMHLCRHLQL
QSPELPCRVFLYQLPGEETYSVNSVAKSGLGLELGPQPQGVLRADLLVRMRALVAAALDF
IQLFNQGTAFPAFEMEAYRNVSSVDFPRTETGDLAGTVHPQLQDRDFEPLRPGAPIFQMF
SGKDVLYEGESTVYPVFINEAAYYEKGIAFLQTEKLTFSVPALPGLAPAPSPAP
NT seq 1065 nt   +upstreamnt  +downstreamnt
ctgcatcctggctgccagggaggctgcgagcaggtgcagcctgctgccctgaggaggctg
ttcaagagccacgaatgtgacagagagccgagctgcctggctgggacgctgggactcgtc
agacctcagggagctcaccacccaccccaccccagctcagcaccgggccctaagcaggcc
cacccaccgggccctccacccacacgggatggggccccgggggagctgcagccacccagc
ttctccgcggtgcccgtgctggccaacccagcggccacagccgcctgccgccgctacgta
gactgtgacctcaaccgcgccttcactggcgccttcctcacggccagggcccacccggat
gacccatatgaggtgacaagggcccgagagctgaaccaactgctgggacccaaggcctcg
ggccaggcctttgacttcgtcctggacctgcacaacaccacggccagcacgggcacctgc
ctcatcgccgaatccgcccacaacgtctttgcgatgcacctgtgccgccacctacagctg
cagagcccagagctgccctgccgggtcttcctgtaccagttgcctggagaagagacttac
agcgtcaactccgtggccaagagcggactgggcctggagctgggcccccagcctcaggga
gtgctgcgggctgaccttctcgtcaggatgagggccttggtggccgcagccctggacttc
atccagctcttcaaccagggcaccgcatttcctgcctttgagatggaagcgtacagaaac
gtgagcagcgtggacttcccacgcacggagaccggggacctggcaggcaccgtgcatcct
cagctgcaggaccgagactttgagccgctgcggcctggagcacccatcttccagatgttc
agcggcaaggacgtgctctatgaaggggagtccactgtgtaccccgtgttcatcaatgag
gccgcctactacgagaagggcattgccttcctccagacggagaagctcacgttctctgtg
cccgccctgcccgggctggcccccgccccctccccggctccctaa

DBGET integrated database retrieval system