KEGG   Myotis brandtii (Brandt's bat): 102254659Help
Entry
102254659         CDS       T02920                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00350  Tyrosine metabolism
myb00360  Phenylalanine metabolism
myb00380  Tryptophan metabolism
myb01100  Metabolic pathways
myb04726  Serotonergic synapse
myb04728  Dopaminergic synapse
myb05030  Cocaine addiction
myb05031  Amphetamine addiction
myb05034  Alcoholism
Module
myb_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
myb_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102254659 (DDC)
   00360 Phenylalanine metabolism
    102254659 (DDC)
   00380 Tryptophan metabolism
    102254659 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102254659 (DDC)
   04726 Serotonergic synapse
    102254659 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    102254659 (DDC)
   05031 Amphetamine addiction
    102254659 (DDC)
   05034 Alcoholism
    102254659 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102254659 (DDC)
Enzymes [BR:myb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102254659 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     102254659 (DDC)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102254659 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102254659
NCBI-ProteinID: XP_014386005
Position
Un
AA seq 259 aa AA seqDB search
AYASDQAHCSVERAALIGGVKFKAIPSDGKFAMRASALQEALQQDKAAGLVPFFVVATLG
TTPCCSFDRLSEVGPLCNWEDLWLHVDAAYAGSAFICPEFRHLLDGVEVGVVRKRADLTG
AFKLDPVYLQHSHQDSGLITDYRHWQLPLGRRFRSLKMWFVFRLYGVTGLQAHIRKHVRL
AHEFEAAVQRDPRFEICAEVTLGLVCFRLKGSNKLNEDLLDRINGAKEIHLVPCHLRDKF
VLRFAICSRAAESAHVQRA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gcctacgcctccgaccaggcccactgctccgtggaaagagcggcactcattggaggagtg
aagttcaaagccatcccctcggacggcaagttcgccatgcgcgcgtccgccctgcaggag
gcgctgcagcaggacaaggccgccgggctggttcctttctttgtggtggccaccctgggg
accacgccctgctgctccttcgaccgcctctccgaagtgggccccctctgtaactgggag
gacctgtggctgcacgtggacgcggcctacgcgggcagcgccttcatctgccccgagttc
cggcacctcctggacggcgtggaggtaggtgtggtgaggaagcgcgcagacctgaccgga
gcctttaagctggaccccgtgtacctgcagcacagccaccaggactcggggctcatcact
gactacaggcactggcagctgccgctgggacgcaggttccgctccctgaagatgtggttc
gtgttccggctgtacggggtcacgggcctgcaggcccacatccgcaagcacgtgcggctg
gcccacgagttcgaagctgcggtgcagcgggaccctcgctttgaaatctgcgcggaagtc
accctggggctggtctgcttccggctgaagggctccaacaagctgaacgaagaccttctg
gacagaatcaacggtgccaaggagatccacctggtcccctgccacctgagggacaagttc
gtgctgcgcttcgccatctgctcccgcgccgccgagtccgcgcacgtgcagcgggcatag

DBGET integrated database retrieval system