KEGG   Myotis brandtii (Brandt's bat): 102255491Help
Entry
102255491         CDS       T02920                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C3
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00140  Steroid hormone biosynthesis
myb00590  Arachidonic acid metabolism
myb00790  Folate biosynthesis
myb01100  Metabolic pathways
myb04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102255491
   00590 Arachidonic acid metabolism
    102255491
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102255491
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102255491
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     102255491
    1.1.1.188  prostaglandin-F synthase
     102255491
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     102255491
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     102255491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 102255491
NCBI-ProteinID: XP_005869576
Position
Un
AA seq 324 aa AA seqDB search
MRAMRHFSVKLNDGHSMPILGFGTSAPNKVAKSKVEEALERAIDVGYRHIDSAYLYLNEE
EIGRAIRKKIANGTVKRDDIFCTSKLWGTFFRPELVQTGLEVSLKKLQLSYVDLFLIHFP
VALKPGEEILPKDTDGKPIFDAVDLCTTWEALEKCKEAGLAKSIGVSNFNCKQLEMILNK
PGLKYKPVCNQVECHLYFNQSKLLDFCKSKDIVLTAYGVLGSDPEKEWVTKNYPVILEDP
VLNVIAEKHQRTAAQVALRYQLQRGLVVLAKSFTEKRIRENFQVFDFQLTPEDMKTLDGL
NRNLRYFKDTYFADHPDYPFNDEY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcaatgagacacttttctgtgaagctgaatgatgggcactccatgcctattctg
ggatttggcacctcagctcctaataaggttgctaagagtaaggtggaagaggcccttgag
agagcaattgatgtaggctatcgccatattgattcagcttacctgtacctaaatgaagaa
gaaattgggagggccatccggaagaaaattgccaatggcactgtgaagagagatgacata
ttctgcacttcaaagctgtggggcacctttttccgtccagaattggtccaaactggtctg
gaagtgtcactgaagaaacttcagctgagctatgtggatctttttcttattcatttccca
gtagctttgaagcctggggaggagattttaccaaaggacacagatgggaaacccattttt
gatgccgtggatctctgtaccacctgggaggccctagagaagtgtaaggaggcaggattg
gccaagtccattggtgtgtccaactttaactgcaagcagctggagatgatcctgaacaaa
ccaggactcaaatacaagcctgtatgcaaccaggtagaatgtcacctgtacttcaaccag
agcaaactgctggacttctgcaagtccaaggacattgtcctcactgcatatggtgtcctg
ggctctgaccccgaaaaggagtgggttaccaagaactacccagttatcctggaggatcca
gtgctcaatgtcattgctgaaaagcaccagcgaaccgcagctcaggtggccctgcgttac
cagctgcagcggggcttggtggtcctggccaaaagcttcactgagaagagaatccgagag
aacttccaggtttttgatttccagttgacaccagaggatatgaaaactctagatggcctc
aacaggaaccttcgctattttaaagacacttattttgctgatcacccagattatccattt
aatgatgaatattga

DBGET integrated database retrieval system