KEGG   Myotis brandtii (Brandt's bat): 102256561Help
Entry
102256561         CDS       T02920                                 

Gene name
ALDOA
Definition
(RefSeq) aldolase, fructose-bisphosphate A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00010  Glycolysis / Gluconeogenesis
myb00030  Pentose phosphate pathway
myb00051  Fructose and mannose metabolism
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb01230  Biosynthesis of amino acids
myb04066  HIF-1 signaling pathway
Module
myb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
myb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102256561 (ALDOA)
   00030 Pentose phosphate pathway
    102256561 (ALDOA)
   00051 Fructose and mannose metabolism
    102256561 (ALDOA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102256561 (ALDOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myb04131]
    102256561 (ALDOA)
   03036 Chromosome and associated proteins [BR:myb03036]
    102256561 (ALDOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102256561 (ALDOA)
Enzymes [BR:myb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     102256561 (ALDOA)
Membrane trafficking [BR:myb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102256561 (ALDOA)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102256561 (ALDOA)
Exosome [BR:myb04147]
 Exosomal proteins
  Proteins found in most exosomes
   102256561 (ALDOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 102256561
NCBI-ProteinID: XP_005882049
Position
Un
AA seq 364 aa AA seqDB search
MTYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKTDDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSNEEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKTAQEEYIKRALANSLACQGKYTPSGQTGAAASQSLFIS
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccaatacccagcgctgaccccggagcaaaagaaggagctaagtgacattgct
caccgcatcgtggctccgggcaagggcatcctggctgcagatgagtccactgggagcatt
gccaagcggctgcagtccattggcactgagaacacggaggagaaccggcgcttctaccgc
cagctgctgctgactgccgatgaccgagtgaatccctgcattgggggtgtcatcctcttc
catgagacactctatcagaagacagatgatgggcgtcccttcccccaagttatcaaatcc
aagggtggtgttgtgggcatcaaggtagacaagggcgtggtacccctggcaggaacaaat
ggtgaaactaccacccaagggctggatgggctgtctgagcgctgtgcccagtacaagaaa
gacggagctgactttgccaagtggcgctgtgtgctgaagattggggaacacaccccctca
gcccttgccatcatggaaaatgccaacgttctggcccgttatgccagcatctgccagcag
aatggcatcgtgcccatcgtggagcctgagatcctccccgatggcgaccatgacttgaag
cgctgtcagtatgtaactgaaaaggtgctggctgctgtctacaaggctctgagtgaccac
cacatctacctggaaggcaccttgctgaagcccaatatggtcaccccaggccatgcctgt
acccagaaattttctaacgaggagattgccatggcaactgtcactgcgctgcgccgcaca
gtgccccccgctgtccctgggatcaccttcctatctggaggtcagagtgaggaggaggca
tccatcaacctcaatgcaatcaacaagtgccccctgctaaagccatgggccttgaccttc
tcctatggccgggccctgcaggcctctgctctgaaggcctggggtggaaagaaggagaac
ctgaagactgcccaggaggaatatatcaagcgagcgctggccaacagcctcgcctgccaa
ggaaagtacaccccaagcggccagactggggctgcggccagccagtccctcttcatctct
aaccatgcctactaa

DBGET integrated database retrieval system