KEGG   Myotis brandtii (Brandt's bat): 102256614Help
Entry
102256614         CDS       T02920                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myb04131]
    102256614 (DOCK8)
Membrane trafficking [BR:myb04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102256614 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 102256614
NCBI-ProteinID: XP_014401808
Position
Un
AA seq 1509 aa AA seqDB search
YSEKGIELLIFFFFSLTQKVPLQNPPIKWAEGHKGVFNIEVQAVSSVHTQDNHLEKFFTL
CHSLESQVTFPIRVLDQKISETTLEHELKLSIIWLNSSRLEPLVLFLHLVLDKLFQLSVQ
PMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPELQKDL
PKSGGPTALADPRYHTYGRTSAAAVSSKLLQARVMSSSNPDLTGTHSAADEEVKNIMSSK
IADRNCNRMSYYSSGNNDVPSATGAPRPTSKKHFHEELALQMVVSTGMVRETVFKYAWFF
FELLVKSMAQYVHNMDKQDNFRRTRFSDRFKDDITTIVNVVTSEIAALLVKPQKETEQAE
KINISLAFFLYDLLSLMDRSFVFNLIKHYCNQLSAKLNNLATLISMRLEFLRILCSHEHY
LNLNLFFMSSDTAPASPCPSISSQNSSSCSSFQDQKIANMFDLTPEFRQQHFLTGLLFTE
LAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDPRCVKPEVKVKVAALYLPLVGIILDAL
PQLYDFTAADARSGKNRASGSDEEQDGTSGINQNVALAIAGNHFNLKTNGPMLSSLPYKQ
YNVLNADTTRNLMICFLWIMKNADQSLIRKWIADLPSMQLSRILDLLFICVSCFEYKGKP
SSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRRVPGNDRFSCLNENLRWKKEQTN
WRQANEKLDKTKAELDQEALISGNLATEANLIILDMQENIIQASSALDCKDSLLGGVLRV
LVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCADLCQRVLHHCSSSMDVTRS
QACATLYLLMRFSFGAISNFARVKMQVTMSLASLVGKAQDFNEEHLRKSLRTILAYAEED
KAMQTTLFPTQVEELLCNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQTSPDLRLTW
LQNMAEKHSKKKCYTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESA
VSEDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRD
FRKLTCTHDKLQKAFDSIISKGHKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLPE
ISHRLEGFYSQCFGAESVEVIKDSAPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYF
EKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEAYRVV
GEGTPDAKILRYSGKENLECSIFNSMDFKCRHYYDQILAFSLTTCVIFMALSSPYNSLLD
YKMEKIRRLFKGVNSKRMQSSWNIISLRPNMKRVMRSLEVRHTCSRNSKCKGYKGRPSLL
WTQEADLAVLFSYFLLQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEK
NKRLITADQREYQQELKKNYNKLKENLRPMIERKIPDLYKPIFRVESQKRDSFHRSSFRK
CETQLSQGS
NT seq 4530 nt NT seq  +upstreamnt  +downstreamnt
tattcagaaaaagggattgaattgctaatctttttttttttttctttaacacagaaagtc
cctttacagaatcctcctattaagtgggctgaaggacataagggagtatttaatattgaa
gtgcaagctgtttcctctgttcacacccaggacaaccacctggagaagttcttcactctc
tgccactccttggagagccaggtgaccttccccatccgcgtgctggaccagaagatcagt
gagacgacgctggagcatgagctgaagctcagcatcatctggctcaactcctcccgcctg
gagcccctcgtgctcttcctgcacctggtgctggacaagctcttccagctgtccgtgcag
cccatggtcatcgccggccagacagccaacttctcccagtttgcctttgagtccgtggtg
gccatcgccaacagtctgcacaacagcaaggacctgagcaaagaccagcatgggaggaac
tgcctgctggcctcctacgtgcactacgtcttccgcctgcccgagctgcagaaggacctg
cccaagtcaggtggccccactgctctcgcggaccctcgctaccacacgtatggacgcact
tctgcagctgcggtgagctcgaagctgctgcaggcccgggtgatgagcagcagtaacccg
gacctcaccgggacacactctgccgctgacgaggaagtgaagaacatcatgtcctcaaag
attgctgatcgcaactgcaaccggatgtcttactatagctctggcaataatgatgttccg
agtgcaaccggagccccaaggccaaccagcaaaaagcatttccatgaggagcttgccctg
cagatggtggtcagcactggaatggtgagagaaacagtcttcaagtacgcctggttcttc
ttcgagctcctggtgaaaagcatggcccagtatgtacacaacatggacaaacaggacaat
tttcggaggactcgtttttccgaccgtttcaaagacgacataactaccattgttaacgtg
gtcacctcggagattgcagcccttttagtaaagcctcagaaggaaactgaacaggcggag
aagatcaacatcagcctggctttcttcttgtatgaccttctctcacttatggatcgtagc
tttgtgtttaacctcatcaaacactattgcaaccagctgtcagccaagctgaacaacctc
gcgacgctcatctccatgaggctagagttcctgagaatcctctgtagccatgaacattac
ctcaacctgaacctcttctttatgagctcggacactgctccagcatctccctgcccctcc
atatcttcccagaactcgagttcctgctccagtttccaggaccagaagatcgccaacatg
ttcgacctgactcctgagttccgccagcagcacttcctcaccggccttctcttcacggaa
ctggctgctgccctggatgcggaaggggaagggatcagcaaagtgcaaaggaaagctgtc
agcgccattcacagcctgttaagttctcacgaccttgacccgcgctgtgtcaaaccagaa
gtgaaggtcaaagtcgctgccctttacttgcctttggttggcatcatcttggatgctttg
ccgcagctctatgactttacagctgcagatgcccgtagtggaaaaaaccgcgccagtggt
tcggatgaagaacaagatgggaccagtggaattaaccagaatgtggccctggccatagct
gggaatcactttaatttgaagacaaatggacccatgctgtcttccttgccctacaagcag
tacaacgtgctgaatgccgacacaacccgaaacctcatgatctgcttcctctggatcatg
aaaaatgcagaccagagcctcattaggaagtggattgctgacctgccctccatgcagctc
agcaggattttagatctccttttcatctgtgtctcgtgttttgagtacaagggaaagccg
agttctgacaaagtcagtacccaagtcctgcagaagtcgagggatgtcaaggccaggctg
gaagaggctttgctccgcggagaaggggccagaggggagatgatgcggcgccgggtccca
gggaatgaccgattttcatgcctaaatgaaaatttgagatggaagaaggagcagacaaat
tggcggcaagctaatgagaagctagataaaacaaaggcagagttagatcaagaagccttg
atcagtggcaatctagcgacagaagcaaatttaatcatcctggacatgcaggaaaacatt
atccaggcaagctcggctctggactgcaaagacagcctgctgggaggtgttctaagggtt
ctggtgaattctctgagctgtgatcagagcaccacctacctgactcactgctttgcaaca
ctccgtgctctcattgccaagttcggcgacttgctgtttgaggaggaggtggagcagtgt
gcggacctgtgtcagcgagtgctgcatcactgcagcagcagcatggacgtcacccggagc
caagcctgtgccaccctctacctcctcatgagattcagttttggagccatcagtaacttt
gcaagagtaaagatgcaggtaaccatgtctctggcatctttggtgggcaaagcacaagac
tttaatgaggagcacctgagaaaatccttgaggaccattttggcctatgcagaagaggac
aaagccatgcagaccactcttttccccacccaggtcgaggaacttctctgcaatctgaat
agcatcctatatgacacagtgaaaatgagggaatttcaggaagatcctgagatgcttatg
gatctcatgtacagaattgccaagagttaccagacatctcccgacctgcggctgacctgg
ctccagaacatggcagagaaacactccaagaagaagtgctacacggaggccgccatgtgc
ctggtgcacgcggctgccttggtggcggaatatctgagcatgctagaggaccacagctac
ctgcccgtgggcagcgtcagctttcagaatatttcttccaatgtgctggaggaatctgca
gtctctgaagataccctgtcgccggatgaggatggcgtgtgctcaggccgctacttcacc
gagagcggcctggtgggcctcctggagcaggcggccgagctgttcagcacgggaggattg
tatgagacagtgaatgaggtctacaaactggtcatccccatcctggaagcgcatcgagac
ttccggaagctgacctgcactcatgacaagctgcagaaggcctttgacagcatcattagc
aagggtcataagagaatgtttggaacctacttccgagttggtttctatggatccaaattt
ggggatttggatgagcaagaatttgtttacaaagagcctgcaattaccaagcttcctgag
atctctcatagactagagggattttatagtcaatgctttggtgcagaatctgtggaagtg
ataaaagactctgctcctgtagacaaaaccaagctggatcctaacaaggcctacatacaa
atcacctttgtggagccttactttgatgagtatgagatgaaagacagggtaacctacttt
gagaagaatttcaatctgcggaggttcatgtacaccacccccttcaccctggaggggcgg
ccgcggggagagctgcatgagcagtaccggcggaataccgtgctgaccaccatgcacgcc
ttcccctacatcaagacccgcatcagcgtcatccagaaggaggaggcttacagggtagtt
ggagaaggcacacctgatgccaaaatcttgcgttatagtgggaaagaaaatcttgagtgc
tctatttttaatagcatggattttaaatgtagacattattacgatcagattctggccttc
tcgcttactacctgtgtcatttttatggcactgtcttcaccttacaactccctcttggac
tataaaatggagaaaataaggaggttgtttaaaggagtaaatagtaagcgtatgcaaagt
tcttggaacataataagcctgagacctaacatgaagcgagtcatgagaagtctagaagtc
agacatacctgtagcaggaacagcaagtgcaaaggctataagggaagaccaagcttgctg
tggacacaagaggctgatttggctgtattattttcctactttctccttcagggaccactg
gaagtagcccaagtgtttttggccgaaattccagctgacccaaaactctatcgacatcac
aacaagttgagattatgctttaaggaattcatcatgcgatgtggtgaggccgtggagaaa
aacaagcgtctcatcacagctgaccagagggaatatcagcaggaactcaaaaagaactac
aacaagctgaaagagaacctcaggcccatgatcgagcggaaaattccagatctctacaag
ccgatattcagagttgaaagtcaaaagagagactccttccacagatctagtttcaggaaa
tgtgaaacccagttgtcacaaggcagctaa

DBGET integrated database retrieval system