KEGG   Myotis brandtii (Brandt's bat): 102256717Help
Entry
102256717         CDS       T02920                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00010  Glycolysis / Gluconeogenesis
myb00562  Inositol phosphate metabolism
myb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102256717 (MINPP1)
   00562 Inositol phosphate metabolism
    102256717 (MINPP1)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102256717 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102256717 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 SID DUF4708
Motif
Other DBs
NCBI-GeneID: 102256717
NCBI-ProteinID: XP_005875996
UniProt: S7PS86
Position
Un
AA seq 274 aa AA seqDB search
MECGPPRINDKLMRFFDHCEKFLTEVERNETALYHVEAFKTGPEMQNILKKVAATLQVPV
NNLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDTDDAMVLEYLNDLKQYWKRGYGYTINS
RSSCILFQDIFQHLDKAVEQKKRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAY
NYKEQMHRKFRSGHIVPYASNLIFVLYHCKNAKTAKEEFRVQLLLNEKVLPLANSQETAS
LYDDLKNHYKDILQSCHTSEECQLPKVNNTSDEL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtggacctccaagaattaatgataaactaatgaggttctttgatcattgtgaa
aagtttttaactgaagtggaaaggaatgagacggctctttatcatgtagaagccttcaaa
actggaccagaaatgcagaacattttaaaaaaagttgcagctactttgcaagtgccagtc
aacaatttaaatgcagatttgattcaggtagcttttttcacctgttcatttgacctggca
attaaaggtgttaaatcgccttggtgtgatgtttttgatacagatgatgcaatggtatta
gaatatttaaatgatctgaaacaatattggaaaagaggatatgggtatactattaatagt
cgatccagctgcatcctgtttcaggatatctttcagcacttggacaaagcagttgaacag
aaaaaaaggtctcagccaatttcctctccagtcatccttcagtttggtcatgcagagact
cttcttccactgctttctctcatgggctacttcaaagacaaggagcccctcacagcttac
aattacaaggaacaaatgcatcggaagttccgaagtggtcacattgtaccttatgcctca
aacctgatatttgtgctttaccattgtaaaaatgctaagactgctaaagaagaattccga
gtgcagttgttattgaatgaaaaggtgttaccattggctaactcgcaagaaactgcttct
ttgtatgatgatctgaagaaccattacaaggacatccttcagagttgtcataccagtgaa
gaatgtcaattaccaaaggtgaacaacacatctgatgagctatga

DBGET integrated database retrieval system