KEGG   Myotis brandtii (Brandt's bat): 102257861Help
Entry
102257861         CDS       T02920                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04020  Calcium signaling pathway
myb04921  Oxytocin signaling pathway
myb04925  Aldosterone synthesis and secretion
myb05214  Glioma
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102257861 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102257861 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    102257861 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102257861 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102257861 (CAMK1G)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102257861 (CAMK1G)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102257861 (CAMK1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal RIO1 APH
Motif
Other DBs
NCBI-GeneID: 102257861
NCBI-ProteinID: XP_005858550
UniProt: S7MGC6
Position
Un
AA seq 462 aa AA seqDB search
MLSSQPVLIFISPCLLLRGAFSEVFLVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLK
KIKHENIVTLEDIYESATHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKY
LHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQSGVMSTACGTPGYVAPEVLAQ
KPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDF
ICHLLEKDPSERYTCEKALRHPWINGNTALHRDIYPSVSLQIQKNFAKSKWRQAFNAATV
VHHMRKLHMNLHSPGVRPEMENRPPVTKASEASRPSSPEITIIEAPALDQSVALPALTRL
PCQHSLRPTAPGGRSLNCLINGSLRISSSLVPMQHGPLAVGPCGCCASCLSIGSKGKSSY
CSEPSLFKKANKKNFKSEVLVPVKASGSSHCRAGQTGVCHIM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctctctagccagccagtactaatttttatttccccgtgtcttctactcagaggagct
ttttcggaagttttcctggtgaagcaaagggtgactgggaagctcttcgccctgaagtgc
atcaagaagtcaccggcattccgggacagcagcctcgagaatgagatcgctgtgctgaaa
aagatcaagcatgaaaacatcgtgaccctagaggacatctatgagagcgccactcactac
tacctggtcatgcagcttgtttccggtggggagctctttgaccggatcctggagcggggt
gtctacacagagaaggacgccagcctggtgatccagcaggtcttgtcagctgtgaaatac
ctccacgagaatggaatcgtccacagagacttaaagcctgaaaacctgctgtacctcacc
cctgaagagaattccaagatcatgatcacagactttggtctgtccaagatggaacagagt
ggcgtcatgtccactgcctgtgggaccccaggctatgttgctccggaagtgttggcccag
aaaccctacagcaaagctgtggattgctggtccattggcgtcatcacttacatattgttg
tgtgggtatcctccgttctacgaagaaactgagtctaagctttttgagaagatcaaagag
ggctactatgagtttgagtctccattctgggatgacatttctgagtcagccaaggacttt
atttgccacttgctggagaaagacccgagtgagcggtacacctgtgagaaggccctgagg
cacccctggattaacgggaacacagccctccaccgggacatctacccctcagtcagcctt
cagatccagaagaactttgccaagagcaagtggaggcaagccttcaacgcagccaccgtg
gtgcaccacatgaggaagctgcacatgaacctgcacagtcccggcgtccgccccgagatg
gagaacaggcctcccgtcacgaaagcctcagaagcttcgagacccagctcccctgagatc
accattatcgaagcccccgccctggaccagagcgtggccctccctgccctgacccggctg
ccctgccagcatagcctccggcccacagctcctggtggcaggtccctcaactgcctgatc
aacggctccctccgcatcagcagcagcctggtgcccatgcagcacgggcccctggcggtg
gggccctgtggctgctgcgccagctgcttgagcatcgggagcaaagggaagtcctcctac
tgctctgagccctcactcttcaaaaaggccaacaaaaagaacttcaagtccgaggtcctg
gtgcccgtcaaagccagtggcagctcccactgccgggcggggcagactggagtctgtcac
attatgtga

DBGET integrated database retrieval system